(data stored in ACNUC7421 zone)

EMBL: CP001630.PE507

CP001630.PE507       Location/Qualifiers
FT   CDS             553647..554780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0514"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V; KEGG: mmr:Mmar10_0555
FT                   phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34481"
FT                   /db_xref="GOA:C6WI30"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI30"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ACU34481.1"
FT                   /translation="MTQTADPTSLVLPADLKPSDGRFGCGPSKVRPEALRALAAEGADL
FT                   MGTSHRQKPVKSLVGEVRSGLRALFSLPEGYEVVLGNGGTTAFWDAAAFGLVRERSQHF
FT                   TYGEFSSKFAKVTKDAPFLGEPVVVKSEPGTAPEITFAEGVDLVGWAHNETSTGVAVPV
FT                   SRPAGSDGALVAIDATSGAGGLPVKAEDFDVYYFAPQKCFASDGGLWLSLMSPAALDRV
FT                   REIGASGRWVPEFLSLTTALDNSTKDQTYNTPSVATLFLLNEQLKWLNGNGGLDWAVSR
FT                   TADSSSRLYSWAEQTSYTSPYVADPAHRSQVVGTVDFADEVDASVVAKVLRANGIVDVE
FT                   PYRKLGRNQLRVAMFPAVEPEDVSTLTEAVDWVVGQL"
     MTQTADPTSL VLPADLKPSD GRFGCGPSKV RPEALRALAA EGADLMGTSH RQKPVKSLVG        60
     EVRSGLRALF SLPEGYEVVL GNGGTTAFWD AAAFGLVRER SQHFTYGEFS SKFAKVTKDA       120
     PFLGEPVVVK SEPGTAPEIT FAEGVDLVGW AHNETSTGVA VPVSRPAGSD GALVAIDATS       180
     GAGGLPVKAE DFDVYYFAPQ KCFASDGGLW LSLMSPAALD RVREIGASGR WVPEFLSLTT       240
     ALDNSTKDQT YNTPSVATLF LLNEQLKWLN GNGGLDWAVS RTADSSSRLY SWAEQTSYTS       300
     PYVADPAHRS QVVGTVDFAD EVDASVVAKV LRANGIVDVE PYRKLGRNQL RVAMFPAVEP       360
     EDVSTLTEAV DWVVGQL                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page