(data stored in ACNUC7421 zone)

EMBL: CP001630.PE508

CP001630.PE508       Location/Qualifiers
FT   CDS             555000..555815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34482"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34482.1"
FT                   /translation="MRTLRVVGLDEDGKSIVLEDPERGERFVLPADERLRAAARGDLTR
FT                   LGQIEVETESQMRPREIQARIRAGESVDQVAAIAGIPAHRVERFAYPVLLERSRIADLA
FT                   QRAHPVREDGPDVQTLGEVVAHSFGLRGQEYVDVSWDSWRGEDGRWVVQLHWTAGRSDN
FT                   RAHWAFHPGAHGGTVTALDDAAVDLMDPNPNRVRSLRAVTHLARAALDVEGRPLAEPEI
FT                   LVREERPVVEEPIVVDGELAEDQPSAKRKKNHPIVPSWEDVLLGVRSRG"
     MRTLRVVGLD EDGKSIVLED PERGERFVLP ADERLRAAAR GDLTRLGQIE VETESQMRPR        60
     EIQARIRAGE SVDQVAAIAG IPAHRVERFA YPVLLERSRI ADLAQRAHPV REDGPDVQTL       120
     GEVVAHSFGL RGQEYVDVSW DSWRGEDGRW VVQLHWTAGR SDNRAHWAFH PGAHGGTVTA       180
     LDDAAVDLMD PNPNRVRSLR AVTHLARAAL DVEGRPLAEP EILVREERPV VEEPIVVDGE       240
     LAEDQPSAKR KKNHPIVPSW EDVLLGVRSR G                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page