(data stored in ACNUC7421 zone)

EMBL: CP001630.PE509

CP001630.PE509       Location/Qualifiers
FT   CDS             556396..556770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34483"
FT                   /db_xref="GOA:C6WI32"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34483.1"
FT                   /translation="MLGRVVVGAALGAGLGAAWMWLRDRIVSGRVCTQEDWGCLELYLV
FT                   MIPVGLVAAVLISWAVFAAAHVGRPLGTAAVSVAFAAALALLTVWFEIPGDVLLTSAVG
FT                   FVLASPVTARRPVVHTAARG"
     MLGRVVVGAA LGAGLGAAWM WLRDRIVSGR VCTQEDWGCL ELYLVMIPVG LVAAVLISWA        60
     VFAAAHVGRP LGTAAVSVAF AAALALLTVW FEIPGDVLLT SAVGFVLASP VTARRPVVHT       120
     AARG                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page