(data stored in ACNUC7421 zone)

EMBL: CP001630.PE51

CP001630.PE51        Location/Qualifiers
FT   CDS             complement(55503..55877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34025"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34025.1"
FT                   /translation="MDLALSKVVELRESGFQFLHLRDEDGQLDRIMAFKQRRGFIDSIL
FT                   FWSETEARAGRLPAVRESSRAAQAVWIYEGPLVEAVDRLLDLPEPGTRNAPTLMRRTAS
FT                   DLAVVTTLPFTLKLPPGAIA"
     MDLALSKVVE LRESGFQFLH LRDEDGQLDR IMAFKQRRGF IDSILFWSET EARAGRLPAV        60
     RESSRAAQAV WIYEGPLVEA VDRLLDLPEP GTRNAPTLMR RTASDLAVVT TLPFTLKLPP       120
     GAIA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page