(data stored in ACNUC7421 zone)

EMBL: CP001630.PE510

CP001630.PE510       Location/Qualifiers
FT   CDS             556763..557443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34484"
FT                   /db_xref="GOA:C6WI33"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34484.1"
FT                   /translation="MAEASRLEAGASTDSFTHRFRLRRATANPRTEDTPVSETISPRTT
FT                   TSTPPPTPTPTSTSTPTDEVTAAHSTPVDTRPRPTIRERGSRAGGFAFSALLRVVLSGV
FT                   VGAALCAAWIAAHQAGLLHRALGEASASLPDFLLLLFVGLPLALVASALLAGPLLWLLG
FT                   VRPAWPIVLLGPVVLAAAHYFDVPNLLAGTGDQWVVLAILAGLSYALAGLLTIPTMLMR
FT                   SRKS"
     MAEASRLEAG ASTDSFTHRF RLRRATANPR TEDTPVSETI SPRTTTSTPP PTPTPTSTST        60
     PTDEVTAAHS TPVDTRPRPT IRERGSRAGG FAFSALLRVV LSGVVGAALC AAWIAAHQAG       120
     LLHRALGEAS ASLPDFLLLL FVGLPLALVA SALLAGPLLW LLGVRPAWPI VLLGPVVLAA       180
     AHYFDVPNLL AGTGDQWVVL AILAGLSYAL AGLLTIPTML MRSRKS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page