(data stored in ACNUC7421 zone)

EMBL: CP001630.PE512

CP001630.PE512       Location/Qualifiers
FT   CDS             557855..559624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0519"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: rce:RC1_1837
FT                   ABC transporter, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34486"
FT                   /db_xref="GOA:C6WI35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI35"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34486.1"
FT                   /translation="MNDQRTSTAATLRRLWPYLRPVKNPIAVSTGAAVLAMLCGLGIPL
FT                   VTQRVVDGPIAHRDLSALPWLIGLVLALGLAEALLFYTRRKVIARPASTVELAMRTDLY
FT                   TRLQALPVSFHDRWQSGQLLSRATSDLTTVRRFVAFVLVFLLVNTTVIVIGLGVLFWLS
FT                   PLLGLVALVSTLPLIALSYLFETRYKVAARLSQDQVGDLTTTVEESVLGIRVLKAFGRG
FT                   PHLAARFQRQARELRGTELVKVRVFAALWAALLVLPELSIAGQLAVGAFGITSGTMTAG
FT                   TLIAAIAVSAYLRWPVDSIGWLLSETNQTAAAVERYFEVLDEPVAITSPPSPKPLATPV
FT                   RGHLRFEGVRFGHPGSDDEVLRGVDLEVRPGETVALVGATGSGKTALTALVPRLADVTG
FT                   GRVTLDGVDVRELDLAELRRVVGTAFEEPVLFSASVTENVVLGGGDASPHAVREALRVA
FT                   RAEEFVDALPWGPDTRIGEQGLSLSGGQRQRLALARAVAGRPAVLVLDDPLSALDVHTE
FT                   AEVEAALRRVLRDVTALVVAHRSSTVQLADRVAVLSGGRITAIGTHRELLAGNTEYRHL
FT                   LSTLADEDEEVRV"
     MNDQRTSTAA TLRRLWPYLR PVKNPIAVST GAAVLAMLCG LGIPLVTQRV VDGPIAHRDL        60
     SALPWLIGLV LALGLAEALL FYTRRKVIAR PASTVELAMR TDLYTRLQAL PVSFHDRWQS       120
     GQLLSRATSD LTTVRRFVAF VLVFLLVNTT VIVIGLGVLF WLSPLLGLVA LVSTLPLIAL       180
     SYLFETRYKV AARLSQDQVG DLTTTVEESV LGIRVLKAFG RGPHLAARFQ RQARELRGTE       240
     LVKVRVFAAL WAALLVLPEL SIAGQLAVGA FGITSGTMTA GTLIAAIAVS AYLRWPVDSI       300
     GWLLSETNQT AAAVERYFEV LDEPVAITSP PSPKPLATPV RGHLRFEGVR FGHPGSDDEV       360
     LRGVDLEVRP GETVALVGAT GSGKTALTAL VPRLADVTGG RVTLDGVDVR ELDLAELRRV       420
     VGTAFEEPVL FSASVTENVV LGGGDASPHA VREALRVARA EEFVDALPWG PDTRIGEQGL       480
     SLSGGQRQRL ALARAVAGRP AVLVLDDPLS ALDVHTEAEV EAALRRVLRD VTALVVAHRS       540
     STVQLADRVA VLSGGRITAI GTHRELLAGN TEYRHLLSTL ADEDEEVRV                   589
//

If you have problems or comments...

PBIL Back to PBIL home page