(data stored in ACNUC7421 zone)

EMBL: CP001630.PE513

CP001630.PE513       Location/Qualifiers
FT   CDS             559621..561579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0520"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: bha:BH1126
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34487"
FT                   /db_xref="GOA:C6WI36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI36"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34487.1"
FT                   /translation="MSASTGNAEDPTGTRTGTAQDPTTPAQDPTTPAQAPTTTAQDPTT
FT                   PPPTVDGWRGVAAEEVDAPDHATGTRLRARSRRLLGSLLRPHAGLVALSLALMVVENLV
FT                   LLAGPLLIAAAIDRGVPAALDGDPTTLAWCVGGYAASGLAATVLRYAFVRLIGRIGQDV
FT                   LLDLRLRVFRHVQRLSVSFHERYTSGKVISRMTNDVDSLQNLLDEGLDGFFNAMLSVFA
FT                   ISVVLFALDVPMALFVLSGFLPLVLLVRWFQARSAAAYRGTTGSIAKVVVQLVETMNGI
FT                   RAVQAFRREPRNERIMADLNGAYRDANVTALTVVATFTSAVRAIGNISLAVLLAWGAWR
FT                   VAEGTLELGVLAAFTLYVRRFYDPMDNIAMFTNAYAAATAALEKLSGLLDERPSVPDPV
FT                   DPVPLGPVRGEVRFEGVEFRYPASDSLVLPRFDLRVPAGQTVALVGATGAGKSTLAKLV
FT                   ARFYDPTGGAVWLDGADLRSVSDADLRRAVVMVTQENFLFEGTVADNIALGRPDATREE
FT                   VVAAAVAVGAHDFIGELPDGYDTDVSKRGGRLSSGQRQLVAFARAFLADPAVLVLDEAT
FT                   SSLDVPTEWTVQSALETVLASRTAFIIAHRLSTVLIADRVLVVDGGRVVEDGTPEELIG
FT                   ERGRFARLHEAWRESLA"
     MSASTGNAED PTGTRTGTAQ DPTTPAQDPT TPAQAPTTTA QDPTTPPPTV DGWRGVAAEE        60
     VDAPDHATGT RLRARSRRLL GSLLRPHAGL VALSLALMVV ENLVLLAGPL LIAAAIDRGV       120
     PAALDGDPTT LAWCVGGYAA SGLAATVLRY AFVRLIGRIG QDVLLDLRLR VFRHVQRLSV       180
     SFHERYTSGK VISRMTNDVD SLQNLLDEGL DGFFNAMLSV FAISVVLFAL DVPMALFVLS       240
     GFLPLVLLVR WFQARSAAAY RGTTGSIAKV VVQLVETMNG IRAVQAFRRE PRNERIMADL       300
     NGAYRDANVT ALTVVATFTS AVRAIGNISL AVLLAWGAWR VAEGTLELGV LAAFTLYVRR       360
     FYDPMDNIAM FTNAYAAATA ALEKLSGLLD ERPSVPDPVD PVPLGPVRGE VRFEGVEFRY       420
     PASDSLVLPR FDLRVPAGQT VALVGATGAG KSTLAKLVAR FYDPTGGAVW LDGADLRSVS       480
     DADLRRAVVM VTQENFLFEG TVADNIALGR PDATREEVVA AAVAVGAHDF IGELPDGYDT       540
     DVSKRGGRLS SGQRQLVAFA RAFLADPAVL VLDEATSSLD VPTEWTVQSA LETVLASRTA       600
     FIIAHRLSTV LIADRVLVVD GGRVVEDGTP EELIGERGRF ARLHEAWRES LA               652
//

If you have problems or comments...

PBIL Back to PBIL home page