(data stored in ACNUC7421 zone)

EMBL: CP001630.PE514

CP001630.PE514       Location/Qualifiers
FT   CDS             562328..562894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0521"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gdj:Gdia_1592
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34488"
FT                   /db_xref="GOA:C6WI37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI37"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34488.1"
FT                   /translation="MRRRGAELERAVLDAATAELLESGYRALTMERVAKRAGTNKNALY
FT                   RRWPHRAALAAAAYRALVADTTRTPDTGDLRADVLALLRGLAADLASPRGEVLTGMVAG
FT                   IAAEAPELLAELRELGAQAGSGVWLTVLGRAVARGEARPEALLPRVAGLPLVLLRNEFL
FT                   TGGPPTDEALVEIVDQVYLPLVRVR"
     MRRRGAELER AVLDAATAEL LESGYRALTM ERVAKRAGTN KNALYRRWPH RAALAAAAYR        60
     ALVADTTRTP DTGDLRADVL ALLRGLAADL ASPRGEVLTG MVAGIAAEAP ELLAELRELG       120
     AQAGSGVWLT VLGRAVARGE ARPEALLPRV AGLPLVLLRN EFLTGGPPTD EALVEIVDQV       180
     YLPLVRVR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page