(data stored in ACNUC7421 zone)

EMBL: CP001630.PE515

CP001630.PE515       Location/Qualifiers
FT   CDS             563263..564681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0522"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bpt:Bpet1644 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34489"
FT                   /db_xref="GOA:C6WI38"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI38"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACU34489.1"
FT                   /translation="MGESAGKTERPAQPEQPAQPAQPELNRAIGPKLLLFFVVGDILGT
FT                   GVYALTGNVAGKIGGALWLPFLIAFAVAFLTAFSYLELVGKYPKAAGAALYAHRAFGVQ
FT                   FLTFMVAFAVMSSGITSAASAALAFGRTYLQSVLREFSSDSVTVSASLVAVLFILGLAV
FT                   VNLRGVSESVKANVVLTCIEVSGLLIIIVIGALAVASGDGDPSRLVQIDPAPGQSALIA
FT                   ITSATSLAFFAMVGFEDSVNMAEECRDPVRIFPRAVLWGMGIAALIYVLVAVTSSLLIP
FT                   ADELAASGSNALLKVVQVGAPSFPLWVFSLIGLFAVINSALINMLMASRLVYGMAGERI
FT                   IPRFFGVVHPTRRTPWVSVLFTTGVAIALVLTTDIAKLGGTTALLLLVVFAIVNVAVLV
FT                   LRKDRADHEHFRAPTIVPVLGALTCAYLASPLSGRPSADYLVALYLLLAGLVLWLINRV
FT                   THGVVEVDPAKLGK"
     MGESAGKTER PAQPEQPAQP AQPELNRAIG PKLLLFFVVG DILGTGVYAL TGNVAGKIGG        60
     ALWLPFLIAF AVAFLTAFSY LELVGKYPKA AGAALYAHRA FGVQFLTFMV AFAVMSSGIT       120
     SAASAALAFG RTYLQSVLRE FSSDSVTVSA SLVAVLFILG LAVVNLRGVS ESVKANVVLT       180
     CIEVSGLLII IVIGALAVAS GDGDPSRLVQ IDPAPGQSAL IAITSATSLA FFAMVGFEDS       240
     VNMAEECRDP VRIFPRAVLW GMGIAALIYV LVAVTSSLLI PADELAASGS NALLKVVQVG       300
     APSFPLWVFS LIGLFAVINS ALINMLMASR LVYGMAGERI IPRFFGVVHP TRRTPWVSVL       360
     FTTGVAIALV LTTDIAKLGG TTALLLLVVF AIVNVAVLVL RKDRADHEHF RAPTIVPVLG       420
     ALTCAYLASP LSGRPSADYL VALYLLLAGL VLWLINRVTH GVVEVDPAKL GK               472
//

If you have problems or comments...

PBIL Back to PBIL home page