(data stored in ACNUC7421 zone)

EMBL: CP001630.PE516

CP001630.PE516       Location/Qualifiers
FT   CDS             564778..565650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0523"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: sfv:SFV_3620
FT                   putative aldose-1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34490"
FT                   /db_xref="GOA:C6WI39"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI39"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACU34490.1"
FT                   /translation="MLEIAHGGARAVIAKVGAGLKSFEVDGVPYVETYDGEPPMGSGAV
FT                   LVPWPNRTAGGTWVLDGAEQQLEIGETARGNAIHGLVRHAEWTVVEHTGSLVSLEVGVE
FT                   GQGWPVPLRTTITYALDDEGLTVSHGVHNLGSARTPFGVGTHPYPRAGKSSTDTSTLTL
FT                   AATTVLPLDPERMIPSGPAVPVSGESDFRAARLLKGVELDTPFGGCEPVDGLVRHQLRG
FT                   PDGGVEVWADPDFKWVQVYTPDNFPGRGRAVAIEPMTCPPDALNSGVDLLWLAPGESWA
FT                   GRWGLRPLA"
     MLEIAHGGAR AVIAKVGAGL KSFEVDGVPY VETYDGEPPM GSGAVLVPWP NRTAGGTWVL        60
     DGAEQQLEIG ETARGNAIHG LVRHAEWTVV EHTGSLVSLE VGVEGQGWPV PLRTTITYAL       120
     DDEGLTVSHG VHNLGSARTP FGVGTHPYPR AGKSSTDTST LTLAATTVLP LDPERMIPSG       180
     PAVPVSGESD FRAARLLKGV ELDTPFGGCE PVDGLVRHQL RGPDGGVEVW ADPDFKWVQV       240
     YTPDNFPGRG RAVAIEPMTC PPDALNSGVD LLWLAPGESW AGRWGLRPLA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page