(data stored in ACNUC7421 zone)

EMBL: CP001630.PE517

CP001630.PE517       Location/Qualifiers
FT   CDS             565670..566863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0524"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bha:BH3008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34491"
FT                   /db_xref="GOA:C6WI40"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI40"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACU34491.1"
FT                   /translation="MSVAITGGYVVPVIGEPIENGTVLVIDGKIAAVGASVEVPDGVPT
FT                   VDAKGSWVLPGFVEAHGHIGVHEEAEGWAGQDTNEMTDPNGARLRALDAINPADMGFAD
FT                   ALSGGVTTAVIKPGSGNPIGGQTVAIKCWGRTTDEMLVREPISVKSALGENPKRVYGDQ
FT                   KKLPSTRQGVAAVIRDAFTAAQDYVARRDAAEGPFDRNPTHEVLAKVLSGELPWCQHCH
FT                   RADDIATALRLADEFGYRLVINHGTEGHLVADLIAERGVPVIVGPLFTTRSKVELRQRT
FT                   LRTPGVLARAGVKVAITTDHPVIPINFLVHQATLAVKEGMDRTAALESITTNPAAILGL
FT                   DDRVGALKPGLDGDVVIWSGDPLDVMSRATKVFVSGREVYSYEDGEGKVADPFYREG"
     MSVAITGGYV VPVIGEPIEN GTVLVIDGKI AAVGASVEVP DGVPTVDAKG SWVLPGFVEA        60
     HGHIGVHEEA EGWAGQDTNE MTDPNGARLR ALDAINPADM GFADALSGGV TTAVIKPGSG       120
     NPIGGQTVAI KCWGRTTDEM LVREPISVKS ALGENPKRVY GDQKKLPSTR QGVAAVIRDA       180
     FTAAQDYVAR RDAAEGPFDR NPTHEVLAKV LSGELPWCQH CHRADDIATA LRLADEFGYR       240
     LVINHGTEGH LVADLIAERG VPVIVGPLFT TRSKVELRQR TLRTPGVLAR AGVKVAITTD       300
     HPVIPINFLV HQATLAVKEG MDRTAALESI TTNPAAILGL DDRVGALKPG LDGDVVIWSG       360
     DPLDVMSRAT KVFVSGREVY SYEDGEGKVA DPFYREG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page