(data stored in ACNUC7421 zone)

EMBL: CP001630.PE518

CP001630.PE518       Location/Qualifiers
FT   CDS             complement(566946..568091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0525"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bat:BAS5190 acyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34492"
FT                   /db_xref="GOA:C6WI41"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI41"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU34492.1"
FT                   /translation="MPAERLLPTTESEDLIALVREIARDELAPKAGLHEEEGRFPRDAF
FT                   RLLGGVGLLGLPYPEDFGGSAQPYEVYLQALEEVATAWMSVAVGLSVHVMSSYALVNFG
FT                   TPEQRAKWLPDALGGELLGGYALSESHAGSDAAALSTRAVREGDEYVVRGTKAWITHGG
FT                   VADFYTLMARTGEPGGRGVSCFFAPGELDGLSAAAPERKMGLTGSVTAQLTFDGARFGA
FT                   DRLIGAEGDGMRIALSALDSGRLGIAACAVGLAQAALDEAVAYARGRSQFGRPIIEFQG
FT                   LEFLLADMAAAVDSARATYLDAARRRDRGLPFTRQAAVAKLVCTDAAMKVTTDAVQVLG
FT                   GAGYTRDFPVERYMREAKVLQIFEGTNQIQRVVIGRALRKA"
     MPAERLLPTT ESEDLIALVR EIARDELAPK AGLHEEEGRF PRDAFRLLGG VGLLGLPYPE        60
     DFGGSAQPYE VYLQALEEVA TAWMSVAVGL SVHVMSSYAL VNFGTPEQRA KWLPDALGGE       120
     LLGGYALSES HAGSDAAALS TRAVREGDEY VVRGTKAWIT HGGVADFYTL MARTGEPGGR       180
     GVSCFFAPGE LDGLSAAAPE RKMGLTGSVT AQLTFDGARF GADRLIGAEG DGMRIALSAL       240
     DSGRLGIAAC AVGLAQAALD EAVAYARGRS QFGRPIIEFQ GLEFLLADMA AAVDSARATY       300
     LDAARRRDRG LPFTRQAAVA KLVCTDAAMK VTTDAVQVLG GAGYTRDFPV ERYMREAKVL       360
     QIFEGTNQIQ RVVIGRALRK A                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page