(data stored in ACNUC7421 zone)

EMBL: CP001630.PE519

CP001630.PE519       Location/Qualifiers
FT   CDS             568174..568770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0526"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rme:Rmet_3794
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34493"
FT                   /db_xref="GOA:C6WI42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI42"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34493.1"
FT                   /translation="MTSIVGRPLTPRQVDLLGKLESLVLAEGFAHFTLDDLAARLHCSK
FT                   STLYALAASKEQLAVRVVRRYFKGAAEHIERRVADLKDAPAKVGTYLAVAAEELRRASA
FT                   RFLADVADYAPTRSTYERNARAAAARLREFIQEGVRDGVFRDVQAVLIAEMAGVLIENI
FT                   QTGVLPRRAGVTDAEAFTALGELLLDGLRRERSQG"
     MTSIVGRPLT PRQVDLLGKL ESLVLAEGFA HFTLDDLAAR LHCSKSTLYA LAASKEQLAV        60
     RVVRRYFKGA AEHIERRVAD LKDAPAKVGT YLAVAAEELR RASARFLADV ADYAPTRSTY       120
     ERNARAAAAR LREFIQEGVR DGVFRDVQAV LIAEMAGVLI ENIQTGVLPR RAGVTDAEAF       180
     TALGELLLDG LRRERSQG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page