(data stored in ACNUC7421 zone)

EMBL: CP001630.PE52

CP001630.PE52        Location/Qualifiers
FT   CDS             56251..57537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34026"
FT                   /db_xref="GOA:C6WDN1"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34026.1"
FT                   /translation="MTSDQRAGLPPLPESMLPRDHALYRPRHSGRQRPALVAAGVYFLL
FT                   PLLLLAVGVRPGEFENRQLAEFPSVTDGWDFFTGLSDWADDHIPLREQAVAAADGISRG
FT                   VFGEPAPLRGPSTGTGPIPEVPSKDPSADRPTPTGHVRVLEGKDDWLYLGLDVEGACDP
FT                   DFLLGDTLGKLKSLRAAVESSGRRFVLVVPPNKSTAMPEKLPSKYYGADCAAKARDDLW
FT                   KRLPETGAIDLRSALADEAKRLQAPVYLQRDSHWNHAGAMVMVRRVAEEVQPGVTGSWK
FT                   VEPAEESKVAADLPTLLGHPEEITLTSYDVLADGKKKAGEPLKGPWDQPKTTTKARGTG
FT                   IANATALLIGDSFSEQAAPYLSGVFTRFTYQNAATIQADPAATARLMVQNDVVVVEMVE
FT                   RNVVIGASSLLAEGTLNEIKAQLAANPKR"
     MTSDQRAGLP PLPESMLPRD HALYRPRHSG RQRPALVAAG VYFLLPLLLL AVGVRPGEFE        60
     NRQLAEFPSV TDGWDFFTGL SDWADDHIPL REQAVAAADG ISRGVFGEPA PLRGPSTGTG       120
     PIPEVPSKDP SADRPTPTGH VRVLEGKDDW LYLGLDVEGA CDPDFLLGDT LGKLKSLRAA       180
     VESSGRRFVL VVPPNKSTAM PEKLPSKYYG ADCAAKARDD LWKRLPETGA IDLRSALADE       240
     AKRLQAPVYL QRDSHWNHAG AMVMVRRVAE EVQPGVTGSW KVEPAEESKV AADLPTLLGH       300
     PEEITLTSYD VLADGKKKAG EPLKGPWDQP KTTTKARGTG IANATALLIG DSFSEQAAPY       360
     LSGVFTRFTY QNAATIQADP AATARLMVQN DVVVVEMVER NVVIGASSLL AEGTLNEIKA       420
     QLAANPKR                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page