(data stored in ACNUC7421 zone)

EMBL: CP001630.PE520

CP001630.PE520       Location/Qualifiers
FT   CDS             568767..569705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0527"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sit:TM1040_3042
FT                   PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34494"
FT                   /db_xref="GOA:C6WI43"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI43"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACU34494.1"
FT                   /translation="MIVVAGEALVDLVPTSEGNLAPRLGGGPFNVAVAVGRLGVPVSFL
FT                   SRVSRDLFGDRVVERLTASGAATDLVTRGPEPTTLAVVGLADDGSARYTFYVEGTADRL
FT                   VADPGPLPSDVRAVSFGTLSMVLEPGASAYEAVLRRESARGALTALDPNIRASLIPDAD
FT                   AYRARFRSWLPDVGLLKVSVEDARWLADLPEDAPEDDVLAAARQWQSEGPAVVVLTRGG
FT                   DGLAVLTGSGEVIHVPPVAVQVVDTIGAGDTVQGALLAWLHDHDALSAEAVRGLDGASW
FT                   IRALSYAGAAAAITCSRAGAEPPFKRELEMT"
     MIVVAGEALV DLVPTSEGNL APRLGGGPFN VAVAVGRLGV PVSFLSRVSR DLFGDRVVER        60
     LTASGAATDL VTRGPEPTTL AVVGLADDGS ARYTFYVEGT ADRLVADPGP LPSDVRAVSF       120
     GTLSMVLEPG ASAYEAVLRR ESARGALTAL DPNIRASLIP DADAYRARFR SWLPDVGLLK       180
     VSVEDARWLA DLPEDAPEDD VLAAARQWQS EGPAVVVLTR GGDGLAVLTG SGEVIHVPPV       240
     AVQVVDTIGA GDTVQGALLA WLHDHDALSA EAVRGLDGAS WIRALSYAGA AAAITCSRAG       300
     AEPPFKRELE MT                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page