(data stored in ACNUC7421 zone)

EMBL: CP001630.PE521

CP001630.PE521       Location/Qualifiers
FT   CDS             569976..571289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0528"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: scl:sce8281 hypothetical protein; TIGRFAM:
FT                   citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34495"
FT                   /db_xref="GOA:C6WI44"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI44"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ACU34495.1"
FT                   /translation="MSDATTAPNDPRTVALRHDGGEHEMQLVRATEGASGIDLGKLLAK
FT                   TGLVTLDSGFVNTASCSSEITYIDGDAGILRYRGYPIEQLAEKSNFLEVSYLLINGELP
FT                   TEAQLADFSSKISRHTLLHEDLKRFFDGFPRDAHPMPVLSSAVSALSTFYQDSLNPFDT
FT                   KQVEMSTIRLLAKVPTIAAYAYKKSVGQPFLYPDNSLGLVENFLRMTFGFPAEPYDVDP
FT                   DLVKALDLLFILHADHEQNCSTSTVRLVGSSEANLFASISAGINALFGPLHGGANSAVL
FT                   EMLEKIRNEGGDVASFVKKVKNKEDGVRLMGFGHRVYKNYDPRAAIIKRTADDILGKLG
FT                   GDDQLLDIAKALEEAALSDDYFVERKLYPNVDFYTGLIYRAMGFPTKFFTVLFALGRLP
FT                   GWIAHWREMINDPATKIGRPRQIYIGSPARDFVPMTER"
     MSDATTAPND PRTVALRHDG GEHEMQLVRA TEGASGIDLG KLLAKTGLVT LDSGFVNTAS        60
     CSSEITYIDG DAGILRYRGY PIEQLAEKSN FLEVSYLLIN GELPTEAQLA DFSSKISRHT       120
     LLHEDLKRFF DGFPRDAHPM PVLSSAVSAL STFYQDSLNP FDTKQVEMST IRLLAKVPTI       180
     AAYAYKKSVG QPFLYPDNSL GLVENFLRMT FGFPAEPYDV DPDLVKALDL LFILHADHEQ       240
     NCSTSTVRLV GSSEANLFAS ISAGINALFG PLHGGANSAV LEMLEKIRNE GGDVASFVKK       300
     VKNKEDGVRL MGFGHRVYKN YDPRAAIIKR TADDILGKLG GDDQLLDIAK ALEEAALSDD       360
     YFVERKLYPN VDFYTGLIYR AMGFPTKFFT VLFALGRLPG WIAHWREMIN DPATKIGRPR       420
     QIYIGSPARD FVPMTER                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page