(data stored in ACNUC7421 zone)

EMBL: CP001630.PE522

CP001630.PE522       Location/Qualifiers
FT   CDS             571555..572820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0529"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: cvi:CV_3481 deoxyribodipyrimidine
FT                   photo-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34496"
FT                   /db_xref="GOA:C6WI45"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI45"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ACU34496.1"
FT                   /translation="MTSSTVVWFRRDLRVEDHPALLEAADRADRALALFVLDPKLLRPS
FT                   GKPRTDFLHRCLKSLDDRLGGRLMVVEGDPVEVVPAVAREIGAETVHVSADTGPYGRRR
FT                   DEAVGEEVELVEAGSPYAVKPGRVRKADGTPYRVFTPFYRAWADHGWRRPADTDASTVD
FT                   WIKPPRSTRPRAKALPDVAELWERFRDERLPDYHRTRDIPGVDGTSRFSAFLRWGVVHP
FT                   RTLLDDLGQDEGSKVFRSELAWREFYADVLWHHPASARHNLDRRFDRIELDEDRDHFDA
FT                   WRQGRTGYPIVDAGMRQLLEEGWMHNRVRMITASFLVKDLHLPWWWGARHFMEHLVDGD
FT                   LASNQHNWQWAAGSGTDAAPYFRVFNPITQGQKFDPKGDYIRRYVPELRDVAGKAVHQP
FT                   RDPIVDHAHERQVALDRFAAIK"
     MTSSTVVWFR RDLRVEDHPA LLEAADRADR ALALFVLDPK LLRPSGKPRT DFLHRCLKSL        60
     DDRLGGRLMV VEGDPVEVVP AVAREIGAET VHVSADTGPY GRRRDEAVGE EVELVEAGSP       120
     YAVKPGRVRK ADGTPYRVFT PFYRAWADHG WRRPADTDAS TVDWIKPPRS TRPRAKALPD       180
     VAELWERFRD ERLPDYHRTR DIPGVDGTSR FSAFLRWGVV HPRTLLDDLG QDEGSKVFRS       240
     ELAWREFYAD VLWHHPASAR HNLDRRFDRI ELDEDRDHFD AWRQGRTGYP IVDAGMRQLL       300
     EEGWMHNRVR MITASFLVKD LHLPWWWGAR HFMEHLVDGD LASNQHNWQW AAGSGTDAAP       360
     YFRVFNPITQ GQKFDPKGDY IRRYVPELRD VAGKAVHQPR DPIVDHAHER QVALDRFAAI       420
     K                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page