(data stored in ACNUC7421 zone)

EMBL: CP001630.PE523

CP001630.PE523       Location/Qualifiers
FT   CDS             complement(572906..573550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0530"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: tgr:Tgr7_2171 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34497"
FT                   /db_xref="GOA:C6WI46"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI46"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34497.1"
FT                   /translation="MRVVLAEDGVLLRAGVEEVLRRFGIEVVASVGDAPALLDAVAAGS
FT                   PDLVLTDVRMPPGDGDDGLRAAVRLRADDPRLPVVVFSQYVAGEYAEELLSSGDGQGVG
FT                   YLLKDRVVDVAEFVDVLRRVAAGGTVIDHEVVRSLLGRRRDPLARLTGREREVLALVAE
FT                   GMANSAVGRRLGVTEAAVHKHVGSILLKLGLPPGVEGNRRVLAVLAYLRAS"
     MRVVLAEDGV LLRAGVEEVL RRFGIEVVAS VGDAPALLDA VAAGSPDLVL TDVRMPPGDG        60
     DDGLRAAVRL RADDPRLPVV VFSQYVAGEY AEELLSSGDG QGVGYLLKDR VVDVAEFVDV       120
     LRRVAAGGTV IDHEVVRSLL GRRRDPLARL TGREREVLAL VAEGMANSAV GRRLGVTEAA       180
     VHKHVGSILL KLGLPPGVEG NRRVLAVLAY LRAS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page