(data stored in ACNUC7421 zone)

EMBL: CP001630.PE524

CP001630.PE524       Location/Qualifiers
FT   CDS             complement(573565..574854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0531"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerization and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mmr:Mmar10_2544 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34498"
FT                   /db_xref="GOA:C6WI47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI47"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34498.1"
FT                   /translation="MDESRDVVGALRRKGFLVSVWPWRALLHALTTPLVAAVAALPLAP
FT                   VGVLWAAVVVKVVRGEVVGGVVPVAALLLGAVLAAALPVLSAPVAWAERWRLVLLGDDR
FT                   LAAVRQAPGLGAWVRSRYLTAAAWRETGYAVLLALAGTGLGGVLLLAGGVPLAMLLAPL
FT                   LVTPDSPLVVLGWRAVTPADGLWFTAAGIALAPVLAYAVGLLGAGHLVVGRVLLRGDEA
FT                   LRAELAEVAGSRARLVDRFDAERRRIERDLHDGAQERLVGLTLRLGLAKAELPENEDVA
FT                   AAHDQAKRLMVELRELVRGIHPAVLTDRGLGAALAELADRSVVPVTLRAHLPTRPPAHL
FT                   ESVAYFVVAEAVANAVKHSGAGEVRVRAGIEGGGVVVEVLDDGRGGADPAAGSGLTGLA
FT                   DRVAVVGGALSLSSPVGGPTVLRATLPLSG"
     MDESRDVVGA LRRKGFLVSV WPWRALLHAL TTPLVAAVAA LPLAPVGVLW AAVVVKVVRG        60
     EVVGGVVPVA ALLLGAVLAA ALPVLSAPVA WAERWRLVLL GDDRLAAVRQ APGLGAWVRS       120
     RYLTAAAWRE TGYAVLLALA GTGLGGVLLL AGGVPLAMLL APLLVTPDSP LVVLGWRAVT       180
     PADGLWFTAA GIALAPVLAY AVGLLGAGHL VVGRVLLRGD EALRAELAEV AGSRARLVDR       240
     FDAERRRIER DLHDGAQERL VGLTLRLGLA KAELPENEDV AAAHDQAKRL MVELRELVRG       300
     IHPAVLTDRG LGAALAELAD RSVVPVTLRA HLPTRPPAHL ESVAYFVVAE AVANAVKHSG       360
     AGEVRVRAGI EGGGVVVEVL DDGRGGADPA AGSGLTGLAD RVAVVGGALS LSSPVGGPTV       420
     LRATLPLSG                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page