(data stored in ACNUC7421 zone)

EMBL: CP001630.PE525

CP001630.PE525       Location/Qualifiers
FT   CDS             complement(575005..576246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0532"
FT                   /product="ABC-type Na+ efflux pump permease component"
FT                   /note="KEGG: scl:sce9075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34499"
FT                   /db_xref="GOA:C6WI48"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI48"
FT                   /inference="protein motif:COG:COG1668"
FT                   /protein_id="ACU34499.1"
FT                   /translation="MSAPSPGRALSPVRAVFLVARREFLSKVRTRSFVIGTVVIIAAMA
FT                   GFVALQALLFTSASTSVVGLNGQATVLAQPLEETARSLGREVEVVDVPDSAAGEELVRS
FT                   GDLDALVLGAPDALRVLVKDGLDPSLANAVDLIVKQQVLAAQLAEAGLDPARVQQNVAD
FT                   ARVRVVALDPEDPMVGQRLVIGLVIAGLLYYSLLVYGTMVAQGVVEEKSSRVVEILLST
FT                   LRPAQLLMGKVIGLGAVGLAQLLLIGAIGLGLASAAGVVAVDGPTGGALLIGVLWYLLG
FT                   FFLYATVFAAAASLVSRQEEVQSVLTPITMLIVIAFVVGFNLLVRDPASRLVAVLSVLP
FT                   PFAPILMPGRMAIGAAPAWQVVLAVALALGAAAGVVWVGGKVYANAVLRTGARVRLRDA
FT                   LRSPRGAAQGSARG"
     MSAPSPGRAL SPVRAVFLVA RREFLSKVRT RSFVIGTVVI IAAMAGFVAL QALLFTSAST        60
     SVVGLNGQAT VLAQPLEETA RSLGREVEVV DVPDSAAGEE LVRSGDLDAL VLGAPDALRV       120
     LVKDGLDPSL ANAVDLIVKQ QVLAAQLAEA GLDPARVQQN VADARVRVVA LDPEDPMVGQ       180
     RLVIGLVIAG LLYYSLLVYG TMVAQGVVEE KSSRVVEILL STLRPAQLLM GKVIGLGAVG       240
     LAQLLLIGAI GLGLASAAGV VAVDGPTGGA LLIGVLWYLL GFFLYATVFA AAASLVSRQE       300
     EVQSVLTPIT MLIVIAFVVG FNLLVRDPAS RLVAVLSVLP PFAPILMPGR MAIGAAPAWQ       360
     VVLAVALALG AAAGVVWVGG KVYANAVLRT GARVRLRDAL RSPRGAAQGS ARG              413
//

If you have problems or comments...

PBIL Back to PBIL home page