(data stored in ACNUC7421 zone)

EMBL: CP001630.PE526

CP001630.PE526       Location/Qualifiers
FT   CDS             complement(576243..577196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0533"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1166 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34500"
FT                   /db_xref="GOA:C6WI49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI49"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34500.1"
FT                   /translation="MSQGLRGLPPHGSPSRGLLEVDRVSKRYGDVVALREMTFEVRAGE
FT                   LFGFVGSNGAGKTTTMRIALGVLEADSGQVRWNGAPIDLRTRRSIGYMPEERGLYPKMR
FT                   VLEQLVYLAELHGVAPGEALRSAELWVERLGLRERRRDEVQKLSLGNQQRVQLAAALVH
FT                   RPEVLVLDEPFSGLDPVAVDVMSQVLREQAAAGVPVVFSSHQLDLVERLCDRVGIVRGG
FT                   AMVACGTVDELRAGGVERLVVEAPGAPPGWADVVPGVLSARHEGARTVVELAPGADDQV
FT                   VLGAALATGPVHEFSRQRPSLTELFRSVVTSEESAA"
     MSQGLRGLPP HGSPSRGLLE VDRVSKRYGD VVALREMTFE VRAGELFGFV GSNGAGKTTT        60
     MRIALGVLEA DSGQVRWNGA PIDLRTRRSI GYMPEERGLY PKMRVLEQLV YLAELHGVAP       120
     GEALRSAELW VERLGLRERR RDEVQKLSLG NQQRVQLAAA LVHRPEVLVL DEPFSGLDPV       180
     AVDVMSQVLR EQAAAGVPVV FSSHQLDLVE RLCDRVGIVR GGAMVACGTV DELRAGGVER       240
     LVVEAPGAPP GWADVVPGVL SARHEGARTV VELAPGADDQ VVLGAALATG PVHEFSRQRP       300
     SLTELFRSVV TSEESAA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page