(data stored in ACNUC7421 zone)

EMBL: CP001630.PE528

CP001630.PE528       Location/Qualifiers
FT   CDS             577666..578109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   lpn:lpg2755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34502"
FT                   /db_xref="GOA:C6WI51"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI51"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACU34502.1"
FT                   /translation="MEPDQWLAQYGQKIEQAKREAAQTEAKLGGVGGSATSPDGLITVT
FT                   VNASGALTDLILRPALRGEDPERIAAAVLKAVAEAQRAAAGQVVEIVSELVGDSPALEF
FT                   VKSRMPNGYSGDGTDPVEPAPEVQRRDTRPDDDYFTNPPDVMA"
     MEPDQWLAQY GQKIEQAKRE AAQTEAKLGG VGGSATSPDG LITVTVNASG ALTDLILRPA        60
     LRGEDPERIA AAVLKAVAEA QRAAAGQVVE IVSELVGDSP ALEFVKSRMP NGYSGDGTDP       120
     VEPAPEVQRR DTRPDDDYFT NPPDVMA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page