(data stored in ACNUC7421 zone)

EMBL: CP001630.PE529

CP001630.PE529       Location/Qualifiers
FT   CDS             578130..578438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34503"
FT                   /db_xref="GOA:C6WI52"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34503.1"
FT                   /translation="MFDSFNVSPEQIRGHAGTVDQLTQRMVTATQTADPSLATDAFGIF
FT                   GSFLAEFLLKQAGVSQDILGQAAETVADMCQGLKEVADLYENVDLDNAFGFTGKARG"
     MFDSFNVSPE QIRGHAGTVD QLTQRMVTAT QTADPSLATD AFGIFGSFLA EFLLKQAGVS        60
     QDILGQAAET VADMCQGLKE VADLYENVDL DNAFGFTGKA RG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page