(data stored in ACNUC7421 zone)

EMBL: CP001630.PE53

CP001630.PE53        Location/Qualifiers
FT   CDS             57672..59063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: FAP262; flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34027"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34027.1"
FT                   /translation="MLADPQPAGGTAALWSSSDLPGLGDQLLVRVIERELRARLGDWCV
FT                   RPFAPHGWTRPQRADAGFIAEPLGERTPHRVRELAENHHLHLVAPSFPLGDDLAARYGA
FT                   DVPGAAFFTAGLGLRPDAACVAVRVAEAVPAELVAWAGRQPLLSVRDEESARRLREAGV
FT                   KGEVAVVGHPGLLLERLLPADSLKARANQLRQLGQLPADGRSYLVVQVPAEGFEKLRPT
FT                   IAKIVELLAVQDVVLLPIGVPVPEGDWAALPPDTVLEDRAAVLADSAAVIAVDEHVAAA
FT                   AQAYGRNWVLLDPTGREGAAAELFGAAERVAQRPSQLAAAFRRALKAGPGGHEEAVRAL
FT                   DEHLDAVAKTAEAAFAASGQGLPDRVAALVAENRALRVAHHRLRERVTADRHAMVELTL
FT                   KGGPVEGGPELEEERRLHGELAERHRELVERLGASERELDAMRRTKLFRYTRALRFVYG
FT                   KLRSR"
     MLADPQPAGG TAALWSSSDL PGLGDQLLVR VIERELRARL GDWCVRPFAP HGWTRPQRAD        60
     AGFIAEPLGE RTPHRVRELA ENHHLHLVAP SFPLGDDLAA RYGADVPGAA FFTAGLGLRP       120
     DAACVAVRVA EAVPAELVAW AGRQPLLSVR DEESARRLRE AGVKGEVAVV GHPGLLLERL       180
     LPADSLKARA NQLRQLGQLP ADGRSYLVVQ VPAEGFEKLR PTIAKIVELL AVQDVVLLPI       240
     GVPVPEGDWA ALPPDTVLED RAAVLADSAA VIAVDEHVAA AAQAYGRNWV LLDPTGREGA       300
     AAELFGAAER VAQRPSQLAA AFRRALKAGP GGHEEAVRAL DEHLDAVAKT AEAAFAASGQ       360
     GLPDRVAALV AENRALRVAH HRLRERVTAD RHAMVELTLK GGPVEGGPEL EEERRLHGEL       420
     AERHRELVER LGASERELDA MRRTKLFRYT RALRFVYGKL RSR                         463
//

If you have problems or comments...

PBIL Back to PBIL home page