(data stored in ACNUC7421 zone)

EMBL: CP001630.PE530

CP001630.PE530       Location/Qualifiers
FT   CDS             578435..580219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted gene, 100041170"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34504"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34504.1"
FT                   /translation="MTPQAGTDVSTAQQRDPANLVGDVKGTADAIERGDWVAAGLGMAN
FT                   AAMSVVGLAGNPMGGLVSAGFSWAVQHVSFLKEPFDALLGNPQAITKMSDSWANAAKQV
FT                   ESIVADYRRTSVEETKGWRGRSADGYRAAATKHSSGLETLAKAAKGISTAAKGAGELVG
FT                   TVRKTIMDLIGKAVSEMVMKIIQWLSVSWLTFGASIAAAIGDIVRMACDYAKKFVDFLQ
FT                   KLATSLKKLIDMIKSVAQIAQTAKQVLQAITAMTHSNSAGAAGAGAAGNPRLSAGGLGL
FT                   TGEQLANMDRGANTRYSENGSGSTWTSGANGAGGGAAVNQPGALGPGAGAGAGSGYDGG
FT                   YGGAGGRPVVSQPPVVGGGFGGVGGGAGGSYGGSTGGSSVSRPPTVGGGVGGSGGSGGY
FT                   GGSGGGAGGSAGGHWEPGRWVPAGSGVTGVTPLPARDVTHATNTTPTIPPLTTPPIPTV
FT                   KPFGGDLGGGGGAGGGAGGGGGPMPSFGGGGGGFGGGGSAGGLGGAGGATPQPMQAGGA
FT                   SGVLPSGAAGGPAPGAPGGAPAGGARGAGGGMGMMGGAPMAPMGGQEGGKDHQRKVRIQ
FT                   GDPLAEEPPKAAKPVIGE"
     MTPQAGTDVS TAQQRDPANL VGDVKGTADA IERGDWVAAG LGMANAAMSV VGLAGNPMGG        60
     LVSAGFSWAV QHVSFLKEPF DALLGNPQAI TKMSDSWANA AKQVESIVAD YRRTSVEETK       120
     GWRGRSADGY RAAATKHSSG LETLAKAAKG ISTAAKGAGE LVGTVRKTIM DLIGKAVSEM       180
     VMKIIQWLSV SWLTFGASIA AAIGDIVRMA CDYAKKFVDF LQKLATSLKK LIDMIKSVAQ       240
     IAQTAKQVLQ AITAMTHSNS AGAAGAGAAG NPRLSAGGLG LTGEQLANMD RGANTRYSEN       300
     GSGSTWTSGA NGAGGGAAVN QPGALGPGAG AGAGSGYDGG YGGAGGRPVV SQPPVVGGGF       360
     GGVGGGAGGS YGGSTGGSSV SRPPTVGGGV GGSGGSGGYG GSGGGAGGSA GGHWEPGRWV       420
     PAGSGVTGVT PLPARDVTHA TNTTPTIPPL TTPPIPTVKP FGGDLGGGGG AGGGAGGGGG       480
     PMPSFGGGGG GFGGGGSAGG LGGAGGATPQ PMQAGGASGV LPSGAAGGPA PGAPGGAPAG       540
     GARGAGGGMG MMGGAPMAPM GGQEGGKDHQ RKVRIQGDPL AEEPPKAAKP VIGE             594
//

If you have problems or comments...

PBIL Back to PBIL home page