(data stored in ACNUC7421 zone)

EMBL: CP001630.PE531

CP001630.PE531       Location/Qualifiers
FT   CDS             580973..582172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0538"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bac:BamMC406_5450
FT                   N-isopropylammelide isopropylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34505"
FT                   /db_xref="GOA:C6WI54"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI54"
FT                   /inference="protein motif:PRIAM:3.5.99.4"
FT                   /protein_id="ACU34505.1"
FT                   /translation="MPGDLLIRSVRPWPADPGAPTVDVLCSNGTLTAFGPHLPAPPGAT
FT                   VVDGRNGVLLPAFTDAHAHLDSTRLGLPFRPHSAGPGLTALVDNDRRHWRADEPVADRA
FT                   TRTLGRTIASGATHVRSHAQVDVDSGLERLEGVLAAREAHRDRALVQVVAFPQCGILRE
FT                   KGTADLLDAALRAGADLIGGLDPASVDRDPVKHLDTVFSLAEKHQCGVDLHLHDDGTLG
FT                   AFQIELVCERVAALGMRGEVTISHAFALSTVDDHRQGLLVDLLAEHDVAVTTVAPGARD
FT                   PLPLHRLRRAGVRLGLGQDGIRDHWSPYGDGDMLGRAWQLAYRGGFRRDDQVEMCVDIA
FT                   TRGGAAVLGARLGLTEGSPASVVVVPGDTVTAAVMDRAPRALVVHAGRVVARDGELVRT
FT                   "
     MPGDLLIRSV RPWPADPGAP TVDVLCSNGT LTAFGPHLPA PPGATVVDGR NGVLLPAFTD        60
     AHAHLDSTRL GLPFRPHSAG PGLTALVDND RRHWRADEPV ADRATRTLGR TIASGATHVR       120
     SHAQVDVDSG LERLEGVLAA REAHRDRALV QVVAFPQCGI LREKGTADLL DAALRAGADL       180
     IGGLDPASVD RDPVKHLDTV FSLAEKHQCG VDLHLHDDGT LGAFQIELVC ERVAALGMRG       240
     EVTISHAFAL STVDDHRQGL LVDLLAEHDV AVTTVAPGAR DPLPLHRLRR AGVRLGLGQD       300
     GIRDHWSPYG DGDMLGRAWQ LAYRGGFRRD DQVEMCVDIA TRGGAAVLGA RLGLTEGSPA       360
     SVVVVPGDTV TAAVMDRAPR ALVVHAGRVV ARDGELVRT                              399
//

If you have problems or comments...

PBIL Back to PBIL home page