(data stored in ACNUC7421 zone)

EMBL: CP001630.PE532

CP001630.PE532       Location/Qualifiers
FT   CDS             complement(582162..583166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0539"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: pzu:PHZ_c1983 alcohol dehydrogenase, zinc-
FT                   containing"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34506"
FT                   /db_xref="GOA:C6WI55"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI55"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU34506.1"
FT                   /translation="MTTAHEIHLAARPKGFPTESDFALVEVPVPAPGDGELLVRNLLMS
FT                   VDPYMRGRMRDAKSYVPPYALDAPLDGGAVGEVVESRSPDFAPGDVVLHGLGWREFAAV
FT                   PASGARKVDPDAAPLGAHLGVLGMPGLTAWVGLLEVAGMREGDAVFVSGAAGAVGQVAG
FT                   QVARLRGAKRVVGSAGSPEKVRYLVDELGFDAAFDYRDGDVAGQLAAAAPDGVDVFFDN
FT                   VGGEHLEAAITAFTTGARAALCGAISAYNAEEAPAGPRNLGLLVGKRATLRGFIVSDHA
FT                   HLREEFTREVGGWIAEGKLRYRETVTEGGLANAPAAFIGMLRGENTGKALVRF"
     MTTAHEIHLA ARPKGFPTES DFALVEVPVP APGDGELLVR NLLMSVDPYM RGRMRDAKSY        60
     VPPYALDAPL DGGAVGEVVE SRSPDFAPGD VVLHGLGWRE FAAVPASGAR KVDPDAAPLG       120
     AHLGVLGMPG LTAWVGLLEV AGMREGDAVF VSGAAGAVGQ VAGQVARLRG AKRVVGSAGS       180
     PEKVRYLVDE LGFDAAFDYR DGDVAGQLAA AAPDGVDVFF DNVGGEHLEA AITAFTTGAR       240
     AALCGAISAY NAEEAPAGPR NLGLLVGKRA TLRGFIVSDH AHLREEFTRE VGGWIAEGKL       300
     RYRETVTEGG LANAPAAFIG MLRGENTGKA LVRF                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page