(data stored in ACNUC7421 zone)

EMBL: CP001630.PE533

CP001630.PE533       Location/Qualifiers
FT   CDS             complement(583222..583977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0540"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_A4874 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34507"
FT                   /db_xref="GOA:C6WI56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI56"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34507.1"
FT                   /translation="MRLHHPSELSARGALIRWSAQVLVPGRDGRAFSRGDAVAVLAPAL
FT                   NRHDRLVLDGSPDDVRALLDEHYAPGLSPLVTSELAAGLGVPVRAAFGWMERADPGDLP
FT                   ERAPECAWLPESDWPEVTALLGAASPHSYVWPGEPGATRWAGIRVGGVLAAVAADAWST
FT                   DGVGFIGGVATHPGFRRQGLSSVLCAFVTAELLERHGGCALMVDRNNPTAIGVYTRLGY
FT                   AYRELSVLDPDVARSGEPKAGGVAGKSAA"
     MRLHHPSELS ARGALIRWSA QVLVPGRDGR AFSRGDAVAV LAPALNRHDR LVLDGSPDDV        60
     RALLDEHYAP GLSPLVTSEL AAGLGVPVRA AFGWMERADP GDLPERAPEC AWLPESDWPE       120
     VTALLGAASP HSYVWPGEPG ATRWAGIRVG GVLAAVAADA WSTDGVGFIG GVATHPGFRR       180
     QGLSSVLCAF VTAELLERHG GCALMVDRNN PTAIGVYTRL GYAYRELSVL DPDVARSGEP       240
     KAGGVAGKSA A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page