(data stored in ACNUC7421 zone)

EMBL: CP001630.PE534

CP001630.PE534       Location/Qualifiers
FT   CDS             complement(584070..584606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34508"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34508.1"
FT                   /translation="MIGGPVAMTAFSASGRVPGQGPGPGSDVGPGMGSGTAQGRGAGSA
FT                   PVPGVNSGFGGALSAAERYKEVVELAGDAVERMRQVDRERVAQLIEALAESQIRMAAAI
FT                   DREKVAELGVDELWQQAVEALWEERSIESIGQRPRPDQTVPPRDQLEYDNEVELAYRGL
FT                   VESLAKRSLFRGGKS"
     MIGGPVAMTA FSASGRVPGQ GPGPGSDVGP GMGSGTAQGR GAGSAPVPGV NSGFGGALSA        60
     AERYKEVVEL AGDAVERMRQ VDRERVAQLI EALAESQIRM AAAIDREKVA ELGVDELWQQ       120
     AVEALWEERS IESIGQRPRP DQTVPPRDQL EYDNEVELAY RGLVESLAKR SLFRGGKS         178
//

If you have problems or comments...

PBIL Back to PBIL home page