(data stored in ACNUC7421 zone)

EMBL: CP001630.PE535

CP001630.PE535       Location/Qualifiers
FT   CDS             complement(584603..587401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0542"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: bpt:Bpet4245
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34509"
FT                   /db_xref="GOA:C6WI58"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI58"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACU34509.1"
FT                   /translation="MSRRDDRLWRIRASLERFHGAVAAALGNAAREQRGIAAERARDMV
FT                   EVMVRGQGVDRALADPVLAGPLRNPLFGPVLAHAMADRVEAFRDWSEQGPDRLAEIVGE
FT                   ASPGAASQPHEAWLGGTGTADGSEGVPELWRIGDGEVPSAPEPRRFPVAVPLLDQAHLH
FT                   VASAPESRATAESLVEGLLLRVLSHFQPGLVQVHVWDVGQLTGSLPGLYPLTRAGLLTV
FT                   HDPARLHELLDELSDTIRRVHTGVLVEGHQSIRAVSGRRAEPWRIAVLLGNRQALKEEH
FT                   QQQLQRVARNGLACGIQLFIVDIPITVNSPVETVRVAADHTATCTMTGKHVRVLLDPPL
FT                   PRHAVPRACAAIAEKREERRSRFGTFADLLPEEPWQERSAAGVVAPVGFFDGDPVPVAL
FT                   GDTSPHALIGGPSGSGKTNLLYAMLGSLAARYSPDELELYLLDFKEGVSFAQFAPGRKD
FT                   PSWLPHARLVGVNVNTDREFGVALLRFLADEMRRRADAAKRHEVTKLEQLREEDPEGRW
FT                   PRVVAVIDEFQYLFGERDQVTAQATQLLEDVARRGRSQGIHLVLSSQDVAGIEGFWGKS
FT                   AIFEQFTVRIALPKARRVLAEPQNDAAVELPRWHAVVNHESGVRPGNRVARVPDATKRG
FT                   TFDALQAELHRMRPEELPEPILFDGSRVPVLGGLADFQALRPGEASPTVLLGQVIDVAG
FT                   SAAKVRFARTPGRNTAVIGSMAEDAAGVLAGAALSLARQHFEGGARFTVACLVDDARPH
FT                   ADRLVKRLRGQGFEVAEVPLKDFREVPEDERRGFREVVDEHAKRLREINAGTFEGDVVP
FT                   EYLVVYGVDAAQSLLEVKDEKTRATGVDSFRLLLKHGPENRTHLLGWWRGAQRLKNSLP
FT                   PGVYDDIGSWIAFDVQGKELLSFGPEQVMSWSPRPRRGLFFDRFEHSRPQVVIPFDTGE
FT                   ES"
     MSRRDDRLWR IRASLERFHG AVAAALGNAA REQRGIAAER ARDMVEVMVR GQGVDRALAD        60
     PVLAGPLRNP LFGPVLAHAM ADRVEAFRDW SEQGPDRLAE IVGEASPGAA SQPHEAWLGG       120
     TGTADGSEGV PELWRIGDGE VPSAPEPRRF PVAVPLLDQA HLHVASAPES RATAESLVEG       180
     LLLRVLSHFQ PGLVQVHVWD VGQLTGSLPG LYPLTRAGLL TVHDPARLHE LLDELSDTIR       240
     RVHTGVLVEG HQSIRAVSGR RAEPWRIAVL LGNRQALKEE HQQQLQRVAR NGLACGIQLF       300
     IVDIPITVNS PVETVRVAAD HTATCTMTGK HVRVLLDPPL PRHAVPRACA AIAEKREERR       360
     SRFGTFADLL PEEPWQERSA AGVVAPVGFF DGDPVPVALG DTSPHALIGG PSGSGKTNLL       420
     YAMLGSLAAR YSPDELELYL LDFKEGVSFA QFAPGRKDPS WLPHARLVGV NVNTDREFGV       480
     ALLRFLADEM RRRADAAKRH EVTKLEQLRE EDPEGRWPRV VAVIDEFQYL FGERDQVTAQ       540
     ATQLLEDVAR RGRSQGIHLV LSSQDVAGIE GFWGKSAIFE QFTVRIALPK ARRVLAEPQN       600
     DAAVELPRWH AVVNHESGVR PGNRVARVPD ATKRGTFDAL QAELHRMRPE ELPEPILFDG       660
     SRVPVLGGLA DFQALRPGEA SPTVLLGQVI DVAGSAAKVR FARTPGRNTA VIGSMAEDAA       720
     GVLAGAALSL ARQHFEGGAR FTVACLVDDA RPHADRLVKR LRGQGFEVAE VPLKDFREVP       780
     EDERRGFREV VDEHAKRLRE INAGTFEGDV VPEYLVVYGV DAAQSLLEVK DEKTRATGVD       840
     SFRLLLKHGP ENRTHLLGWW RGAQRLKNSL PPGVYDDIGS WIAFDVQGKE LLSFGPEQVM       900
     SWSPRPRRGL FFDRFEHSRP QVVIPFDTGE ES                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page