(data stored in ACNUC7421 zone)

EMBL: CP001630.PE538

CP001630.PE538       Location/Qualifiers
FT   CDS             complement(588061..589773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34512"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34512.1"
FT                   /translation="MSGQDLELVITVVVTAHDERQALDACAGLLRRIGGRIVQTRDCSD
FT                   EEPGCWSLTVFKESGESAEHSVPAALTRAVRRFVRGLGEHFPTPKVACEPPTAWTVLDD
FT                   VHLLGPLVQGAERVLVEAWAGGDPLRRSPVPAPREERPPAPVPIAPAAAPAPRSAEPVI
FT                   PAQPDTAPPDAPEQDAEPPRAEPLALPEATPTAEPQTAPEPAEPQAPLATPEPVEPTAP
FT                   QEPLATPGPFAPAESQEPPATHEPLAPASAATPLEPSSFPVSPETPEPSSTPVSPEAPA
FT                   HPAAPVSPEAQVSPAGPVPPEAPPVPAPSPAPAAPRRPAGPTGSAPTWAGAAAAWPTPV
FT                   WPAPVWPAPVPTARPERGVVAPPPPGFPPGVEIPAISAVPAAPTGPAAPTGPAEPTGPA
FT                   EPAAPAEPAAPAEPSTTPFPVLPPAPPQPLPEPAPLPTPQDEPAPAPPEPLSDSPVRLI
FT                   LEIRAIADPTSPPEEQARSVARPLVPAGKITRVAPGGRLLAVHVDLGASEAPPTSALLD
FT                   AAAAMTPDGWSGVERVGISAVVRWSAGPTPTTGVTSLELTATPLSAFQWTEPA"
     MSGQDLELVI TVVVTAHDER QALDACAGLL RRIGGRIVQT RDCSDEEPGC WSLTVFKESG        60
     ESAEHSVPAA LTRAVRRFVR GLGEHFPTPK VACEPPTAWT VLDDVHLLGP LVQGAERVLV       120
     EAWAGGDPLR RSPVPAPREE RPPAPVPIAP AAAPAPRSAE PVIPAQPDTA PPDAPEQDAE       180
     PPRAEPLALP EATPTAEPQT APEPAEPQAP LATPEPVEPT APQEPLATPG PFAPAESQEP       240
     PATHEPLAPA SAATPLEPSS FPVSPETPEP SSTPVSPEAP AHPAAPVSPE AQVSPAGPVP       300
     PEAPPVPAPS PAPAAPRRPA GPTGSAPTWA GAAAAWPTPV WPAPVWPAPV PTARPERGVV       360
     APPPPGFPPG VEIPAISAVP AAPTGPAAPT GPAEPTGPAE PAAPAEPAAP AEPSTTPFPV       420
     LPPAPPQPLP EPAPLPTPQD EPAPAPPEPL SDSPVRLILE IRAIADPTSP PEEQARSVAR       480
     PLVPAGKITR VAPGGRLLAV HVDLGASEAP PTSALLDAAA AMTPDGWSGV ERVGISAVVR       540
     WSAGPTPTTG VTSLELTATP LSAFQWTEPA                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page