(data stored in ACNUC7421 zone)

EMBL: CP001630.PE539

CP001630.PE539       Location/Qualifiers
FT   CDS             590316..590795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34513"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34513.1"
FT                   /translation="MTGHTVLWDPVRLTAAEFAGCWEQLDLGEPPGALGLSDVDPVWPA
FT                   EVLVGLRRKGIALRGARLERQLRALARRDYAVDVDGCRVRVRASVVGSIGVLAERRGDE
FT                   VVLVSVPHYAVPAELLARLPESASVEVTRDGALVGASRCGPRDEAAELIERTRPG"
     MTGHTVLWDP VRLTAAEFAG CWEQLDLGEP PGALGLSDVD PVWPAEVLVG LRRKGIALRG        60
     ARLERQLRAL ARRDYAVDVD GCRVRVRASV VGSIGVLAER RGDEVVLVSV PHYAVPAELL       120
     ARLPESASVE VTRDGALVGA SRCGPRDEAA ELIERTRPG                              159
//

If you have problems or comments...

PBIL Back to PBIL home page