(data stored in ACNUC7421 zone)

EMBL: CP001630.PE54

CP001630.PE54        Location/Qualifiers
FT   CDS             59060..60733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0054"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_0824 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34028"
FT                   /db_xref="GOA:C6WDN3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34028.1"
FT                   /translation="MTPRITFVLVTYGGGELAAHCLDVLAEHTPEPYEVVVVDSASPDG
FT                   SGEWLERNLTGATVVRMTENLGFGAGCNLGVQHARTEFVCFLNADVEVTEGWLAPLLEL
FT                   LDGTPAAAAAAPLMVFPDGRLQEAGSLLGGDAFSRGWGDGWEDGAELYPRVVDYASAAC
FT                   LVVRRRAFHDVGGFSSEYHIAYYEDTDLQFGLRDRGWQVWVQPSSHVVHVRHGTSSTAT
FT                   AERLSDINREVFRRRWADDLALRPPALGVHEHPHRLWWLRDKPASVRVLVVAPGAPADG
FT                   DRDAALLSAWRADPEAAVTLLVPEDAADDGAFARWRSRGVEVRPGDAGEASRERVGNYD
FT                   VVVALGDVPVEAVTRWQRAAVKALDLASLPHRAHERRFALSRAKEDAVRAGAARARTAE
FT                   LLQWADVVSCASEEDAEWVRGGAGATAHVLTHPVEAPPVLCELADRVTGDAAGDVDLAV
FT                   RRVLVAPFPGSAGLRPELVRAMAVGTPFVTTWEGADGLGLPGWVFECTEEQLLTDDELW
FT                   GRVHRELVAAHRARFAPERFRAVFADLQADCGVAPAPLVP"
     MTPRITFVLV TYGGGELAAH CLDVLAEHTP EPYEVVVVDS ASPDGSGEWL ERNLTGATVV        60
     RMTENLGFGA GCNLGVQHAR TEFVCFLNAD VEVTEGWLAP LLELLDGTPA AAAAAPLMVF       120
     PDGRLQEAGS LLGGDAFSRG WGDGWEDGAE LYPRVVDYAS AACLVVRRRA FHDVGGFSSE       180
     YHIAYYEDTD LQFGLRDRGW QVWVQPSSHV VHVRHGTSST ATAERLSDIN REVFRRRWAD       240
     DLALRPPALG VHEHPHRLWW LRDKPASVRV LVVAPGAPAD GDRDAALLSA WRADPEAAVT       300
     LLVPEDAADD GAFARWRSRG VEVRPGDAGE ASRERVGNYD VVVALGDVPV EAVTRWQRAA       360
     VKALDLASLP HRAHERRFAL SRAKEDAVRA GAARARTAEL LQWADVVSCA SEEDAEWVRG       420
     GAGATAHVLT HPVEAPPVLC ELADRVTGDA AGDVDLAVRR VLVAPFPGSA GLRPELVRAM       480
     AVGTPFVTTW EGADGLGLPG WVFECTEEQL LTDDELWGRV HRELVAAHRA RFAPERFRAV       540
     FADLQADCGV APAPLVP                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page