(data stored in ACNUC7421 zone)

EMBL: CP001630.PE540

CP001630.PE540       Location/Qualifiers
FT   CDS             complement(590868..591659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0547"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: spe:Spro_0615
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34514"
FT                   /db_xref="GOA:C6WI63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI63"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34514.1"
FT                   /translation="MIESNVPGRAGELVVRTWPNLEATWLAVLVHGCGEHAGRYGHVAE
FT                   ALVAAGALVVAADQAGHGASEGERALVEDLGTLVGDVDTVIGAAGVDLPVVLVGHGVGG
FT                   LVAARYAQDHQDRLAALVLSAPVLGAWEGLDALGGDDLSGTEVDPAELSRDEEVGRAYA
FT                   ADPLVWHGPVPRPTLEAVERAIDEVNFGPVLDRVPVLWLHGGADRLVPEADTRTGADRL
FT                   RGARFEERVYPGARHEVLRETNRDEVLGDVVDFARRALGGS"
     MIESNVPGRA GELVVRTWPN LEATWLAVLV HGCGEHAGRY GHVAEALVAA GALVVAADQA        60
     GHGASEGERA LVEDLGTLVG DVDTVIGAAG VDLPVVLVGH GVGGLVAARY AQDHQDRLAA       120
     LVLSAPVLGA WEGLDALGGD DLSGTEVDPA ELSRDEEVGR AYAADPLVWH GPVPRPTLEA       180
     VERAIDEVNF GPVLDRVPVL WLHGGADRLV PEADTRTGAD RLRGARFEER VYPGARHEVL       240
     RETNRDEVLG DVVDFARRAL GGS                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page