(data stored in ACNUC7421 zone)

EMBL: CP001630.PE541

CP001630.PE541       Location/Qualifiers
FT   CDS             complement(591709..592527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0548"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dvm:DvMF_0511 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34515"
FT                   /db_xref="GOA:C6WI64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI64"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34515.1"
FT                   /translation="MDTRLLRTLLVLARTGSFTATAAELHLVQSSVTSQVKVLERHLGA
FT                   RLFDRLPQGARLTEAGRKAVENARDVLSAEQRLLDAVRGSTEVEGDVRIGAPESVCAYR
FT                   LPQRIADAALRWPGITVHLSPAGTKEVLLGVRRGTLDLGLALDDGLVAPGLSAHPVGVE
FT                   PIELVAAPGAVAEDRYFLLEEGCSYTDRFVRELRGRRPQITRFGSIEAVRSCVVAGLGW
FT                   TVLPRVAVAEQLESGALRRLGELPDSTLYLVTDPRRTLPAAVRAVAEAVL"
     MDTRLLRTLL VLARTGSFTA TAAELHLVQS SVTSQVKVLE RHLGARLFDR LPQGARLTEA        60
     GRKAVENARD VLSAEQRLLD AVRGSTEVEG DVRIGAPESV CAYRLPQRIA DAALRWPGIT       120
     VHLSPAGTKE VLLGVRRGTL DLGLALDDGL VAPGLSAHPV GVEPIELVAA PGAVAEDRYF       180
     LLEEGCSYTD RFVRELRGRR PQITRFGSIE AVRSCVVAGL GWTVLPRVAV AEQLESGALR       240
     RLGELPDSTL YLVTDPRRTL PAAVRAVAEA VL                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page