(data stored in ACNUC7421 zone)

EMBL: CP001630.PE542

CP001630.PE542       Location/Qualifiers
FT   CDS             592602..593429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0549"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   aha:AHA_2368 putative phenazine biosynthesis protein PhzF"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34516"
FT                   /db_xref="GOA:C6WI65"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI65"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ACU34516.1"
FT                   /translation="MSNVLRYAAFTTTPTGGNPAGVVLDARGLTPERMLATAAEVGYSE
FT                   TAFLLPGPDPRRFAVRYFSPEAEVPFCGHATVAAAVALGLPGAIALDTAAGEVLVDVDG
FT                   GTATLTSVPTRTRPAPDADVDAALAALRWSRADLDPELPVRWAFGGGWHLVVAVRDRAV
FT                   LAALDYDFPALRALLAGADALTAQLVHRRAPDLFDARDPFPVGGVVEDPATGAAAAAFG
FT                   GYLRELGQLPDGGRFVLHQGVDMGRPSELVVVAEPGAPGVRVTGAAVPIDALG"
     MSNVLRYAAF TTTPTGGNPA GVVLDARGLT PERMLATAAE VGYSETAFLL PGPDPRRFAV        60
     RYFSPEAEVP FCGHATVAAA VALGLPGAIA LDTAAGEVLV DVDGGTATLT SVPTRTRPAP       120
     DADVDAALAA LRWSRADLDP ELPVRWAFGG GWHLVVAVRD RAVLAALDYD FPALRALLAG       180
     ADALTAQLVH RRAPDLFDAR DPFPVGGVVE DPATGAAAAA FGGYLRELGQ LPDGGRFVLH       240
     QGVDMGRPSE LVVVAEPGAP GVRVTGAAVP IDALG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page