(data stored in ACNUC7421 zone)

EMBL: CP001630.PE543

CP001630.PE543       Location/Qualifiers
FT   CDS             593919..594908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0550"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bcm:Bcenmc03_5299 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34517"
FT                   /db_xref="GOA:C6WI66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI66"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34517.1"
FT                   /translation="MPELELRHLRAVCAIAEEGSLTKAASRLGLTQPAMSAQLRTVERI
FT                   VGGRLFERTPGGSVPTELGRQVVGSARLVLDEVGGLVRLARERSSGADRGPLLVGSVPT
FT                   LFFGDLVTELRRAVPGVEIRTETMQGGSELLEKLVAGQFHVAVLDWFEGLDTRELRGVE
FT                   VRRLVSEPHFVALPEWDRLARQDEVDLAELADRDWVTPPDQFIGNRLQIVAACAGAGFT
FT                   PRFTHHANEASSARGLVASGAVCFALPQSRGGDGIVVKPLKGSPLLIDVLVATRRDGPV
FT                   AGRAHEVYACAARAYRALLPRNPAFEKWWADHPEAHAELDTALLVDPA"
     MPELELRHLR AVCAIAEEGS LTKAASRLGL TQPAMSAQLR TVERIVGGRL FERTPGGSVP        60
     TELGRQVVGS ARLVLDEVGG LVRLARERSS GADRGPLLVG SVPTLFFGDL VTELRRAVPG       120
     VEIRTETMQG GSELLEKLVA GQFHVAVLDW FEGLDTRELR GVEVRRLVSE PHFVALPEWD       180
     RLARQDEVDL AELADRDWVT PPDQFIGNRL QIVAACAGAG FTPRFTHHAN EASSARGLVA       240
     SGAVCFALPQ SRGGDGIVVK PLKGSPLLID VLVATRRDGP VAGRAHEVYA CAARAYRALL       300
     PRNPAFEKWW ADHPEAHAEL DTALLVDPA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page