(data stored in ACNUC7421 zone)

EMBL: CP001630.PE544

CP001630.PE544       Location/Qualifiers
FT   CDS             complement(594981..595796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0551"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: mxa:MXAN_5100 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34518"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI67"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACU34518.1"
FT                   /translation="MTTLITGATGHLGALIADHVLTRIPASELAVSTRSPEKAEALSAR
FT                   GVDVRKADFDDAESLRAAFAGVDRLVLVSADGPDRIAQHTRVVEAAKAAGVSFIAYTSV
FT                   VDADTSTLSLAPDHAATERVIRESGIAFAFLRNGMYHENYTQALGHGVVAHAAGDGRNA
FT                   SASRHDLAEAAAVVVTGEGHEGKVYELTGPSAWTFAELAALAGDEAKPVTAQERIAGLV
FT                   GFGLPDFVAELLTDIEVNIGRGALERVTDDLPTLLGRPATPIAEAVANR"
     MTTLITGATG HLGALIADHV LTRIPASELA VSTRSPEKAE ALSARGVDVR KADFDDAESL        60
     RAAFAGVDRL VLVSADGPDR IAQHTRVVEA AKAAGVSFIA YTSVVDADTS TLSLAPDHAA       120
     TERVIRESGI AFAFLRNGMY HENYTQALGH GVVAHAAGDG RNASASRHDL AEAAAVVVTG       180
     EGHEGKVYEL TGPSAWTFAE LAALAGDEAK PVTAQERIAG LVGFGLPDFV AELLTDIEVN       240
     IGRGALERVT DDLPTLLGRP ATPIAEAVAN R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page