(data stored in ACNUC7421 zone)

EMBL: CP001630.PE545

CP001630.PE545       Location/Qualifiers
FT   CDS             595883..596269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0552"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   mxa:MXAN_5099 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34519"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ87"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU34519.1"
FT                   /translation="MDGMATTGDVYDRNCPSRQIASHATSQWGGLVLGKLLEGKLRFSE
FT                   LRRAVVGVSEKMLAQTLQALERDGLVLREVHPVIPPHVDYSLTPAGAQLAARVRGLYDW
FT                   IEDNLPDLCAARDAYDAKRAGTTV"
     MDGMATTGDV YDRNCPSRQI ASHATSQWGG LVLGKLLEGK LRFSELRRAV VGVSEKMLAQ        60
     TLQALERDGL VLREVHPVIP PHVDYSLTPA GAQLAARVRG LYDWIEDNLP DLCAARDAYD       120
     AKRAGTTV                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page