(data stored in ACNUC7421 zone)

EMBL: CP001630.PE546

CP001630.PE546       Location/Qualifiers
FT   CDS             596361..597458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0553"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: pae:PA4164
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34520"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ88"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ACU34520.1"
FT                   /translation="MGGIRKHTASGAALALPFTDDRHPAEPYPGARPGACFVHLDGAGW
FT                   PVDPDPMTDSGWRVSPDGVDLDEWLAGHGEPPMAERTPVLAYGSNANPAKVTWLREELG
FT                   LTGPAVVLRARCEGLAAVWASGLRKVDGQRPATLAAMPDVTEEHAVWFATAEQLRVLDR
FT                   CEGRGLRYRLVRVHSGRVTLFDGSVVDSVLAYTGAGRRRMPLLSAGEPVRCAEVDQVGA
FT                   RWLGGRPAPDDGLDVTPVHGYPAPDEWPDRLFAYGTLQPGQSAWGLVEPLTSGSPEPAR
FT                   ASGTLHDTGLGYPALRPGGGGANVPGHVLRLTSPEEALPVLDKYEGDEYRRVRVTLPDG
FT                   RVCWTYLWRGPVDGFAELPEGWVRR"
     MGGIRKHTAS GAALALPFTD DRHPAEPYPG ARPGACFVHL DGAGWPVDPD PMTDSGWRVS        60
     PDGVDLDEWL AGHGEPPMAE RTPVLAYGSN ANPAKVTWLR EELGLTGPAV VLRARCEGLA       120
     AVWASGLRKV DGQRPATLAA MPDVTEEHAV WFATAEQLRV LDRCEGRGLR YRLVRVHSGR       180
     VTLFDGSVVD SVLAYTGAGR RRMPLLSAGE PVRCAEVDQV GARWLGGRPA PDDGLDVTPV       240
     HGYPAPDEWP DRLFAYGTLQ PGQSAWGLVE PLTSGSPEPA RASGTLHDTG LGYPALRPGG       300
     GGANVPGHVL RLTSPEEALP VLDKYEGDEY RRVRVTLPDG RVCWTYLWRG PVDGFAELPE       360
     GWVRR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page