(data stored in ACNUC7421 zone)

EMBL: CP001630.PE547

CP001630.PE547       Location/Qualifiers
FT   CDS             597634..598308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0554"
FT                   /product="peptidase C14, caspase catalytic subunit P20"
FT                   /note="KEGG: rpc:RPC_3182 peptidase C14, caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34521"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ89"
FT                   /inference="similar to AA sequence:KEGG:RPC_3182"
FT                   /protein_id="ACU34521.1"
FT                   /translation="MRRRLIAVCGVALAGVLAACGGGARPAAEQGELTGALTTEAAPSS
FT                   AATGSSGPGASVEGAPNSADPGGGADPVPPSEPGGQPPGAGGRCTAASLTGRFQPTDAG
FT                   AGNRHGMFVVTNTGDRTCTLTGYSGLQLLDAAGGPVPTDLVRTGRPAPEPVVVEPGASA
FT                   SADLRWTVVPTGDEPVEGPCEPQPASAAAIPPDETQPLTVTWPGGPVCGGGKIEISPFR
FT                   AA"
     MRRRLIAVCG VALAGVLAAC GGGARPAAEQ GELTGALTTE AAPSSAATGS SGPGASVEGA        60
     PNSADPGGGA DPVPPSEPGG QPPGAGGRCT AASLTGRFQP TDAGAGNRHG MFVVTNTGDR       120
     TCTLTGYSGL QLLDAAGGPV PTDLVRTGRP APEPVVVEPG ASASADLRWT VVPTGDEPVE       180
     GPCEPQPASA AAIPPDETQP LTVTWPGGPV CGGGKIEISP FRAA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page