(data stored in ACNUC7421 zone)

EMBL: CP001630.PE548

CP001630.PE548       Location/Qualifiers
FT   CDS             complement(598611..600047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1735 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34522"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34522.1"
FT                   /translation="MVNGSVVGSGPVGSGAVGLEARVGALLDEALALYRDSPRAVSWLR
FT                   GHRARFAEPVRVAVAGGHGTGKSTLVSALVGEELTAPPTATAWYRDGARPAAWVGAHEV
FT                   PVVRRDDGVRVEAGGAERVVVEWPARSLRDLVLVDTRPDAPVELVFGEADAVLHLTRHV
FT                   RDEDLERLRAGHDHPIARAAPVTTLLVLARADEIGGGRIDALSSAKQIARRCRRDPAVR
FT                   GLCQDAVAFAGLLAVASRTLRDEEFAALGALSGLARAELDGHLLSADRFAGEDFPVALG
FT                   ASARQRLLDRLGLFGVRLCTTLIRQGFDTRVKLTGQLAQRSGLGELREAIGAHLTERRG
FT                   ALKARSALLGLDVVLRAEPRPGSVGLLGALERVVAGAHDFRELRLLAALAGGRVSLPGE
FT                   LGEEATRLVGGAGTGAAARLGAEEQGLSGRELRHLLLDVLGRWREHAASPVLDNAQRRA
FT                   AGVVVRSCEGVLVERGGVAG"
     MVNGSVVGSG PVGSGAVGLE ARVGALLDEA LALYRDSPRA VSWLRGHRAR FAEPVRVAVA        60
     GGHGTGKSTL VSALVGEELT APPTATAWYR DGARPAAWVG AHEVPVVRRD DGVRVEAGGA       120
     ERVVVEWPAR SLRDLVLVDT RPDAPVELVF GEADAVLHLT RHVRDEDLER LRAGHDHPIA       180
     RAAPVTTLLV LARADEIGGG RIDALSSAKQ IARRCRRDPA VRGLCQDAVA FAGLLAVASR       240
     TLRDEEFAAL GALSGLARAE LDGHLLSADR FAGEDFPVAL GASARQRLLD RLGLFGVRLC       300
     TTLIRQGFDT RVKLTGQLAQ RSGLGELREA IGAHLTERRG ALKARSALLG LDVVLRAEPR       360
     PGSVGLLGAL ERVVAGAHDF RELRLLAALA GGRVSLPGEL GEEATRLVGG AGTGAAARLG       420
     AEEQGLSGRE LRHLLLDVLG RWREHAASPV LDNAQRRAAG VVVRSCEGVL VERGGVAG         478
//

If you have problems or comments...

PBIL Back to PBIL home page