(data stored in ACNUC7421 zone)

EMBL: CP001630.PE549

CP001630.PE549       Location/Qualifiers
FT   CDS             complement(600103..601911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0556"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   scl:sce0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34523"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ91"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACU34523.1"
FT                   /translation="MSAPWLDVLDDTIRACAARNRPDLAARLREKRASQLDPRIRVLVV
FT                   GESKQGKSQLVNALINAPVCAVGDDVTTAVPTFVQHAETPSATLLRGGSIADTPTERIP
FT                   VPIDQVARAVSGRAGGEVLAAEVGIPRELLASGLVLIDTPGTGDPRGARAASTYAALLQ
FT                   ADAVLMVTDATAELSASELELLRRVLAACPNVTVVLTKTDLSAQWRQVLQRDRAHLARA
FT                   GVGAKVLPVSSALRLRAARTGDRELNAESGFPELLACVQRDIVAAADVLGRRSVAAAAA
FT                   SAVKQLVAPLKEELASMGARGPEDTIAALHEAQRRVDELRRRSARWQTVLADEMADLVS
FT                   DVEYDLRDRTRGILREVDRTFETADPGKVWDEFEPWLRTSLTEAATTNFAWLLERAEWV
FT                   AEKVARSFPVHRDDLLPESVFPDDLLDRVAEMDAPTLERFTASQKFFTGLRGSYGGVLM
FT                   LGLVTSLAGMPLINAVSLGAGALFGGRSVLEEGEQRLKRRQAAAKQSVQRHVDDFFVKF
FT                   SKDCRDAARHVQRSLRDHFSTIAEELQETLLESARSARRAVQDDATERERRTREAKGEL
FT                   DGLVQLYQRVQAVAGVGAATPLSITA"
     MSAPWLDVLD DTIRACAARN RPDLAARLRE KRASQLDPRI RVLVVGESKQ GKSQLVNALI        60
     NAPVCAVGDD VTTAVPTFVQ HAETPSATLL RGGSIADTPT ERIPVPIDQV ARAVSGRAGG       120
     EVLAAEVGIP RELLASGLVL IDTPGTGDPR GARAASTYAA LLQADAVLMV TDATAELSAS       180
     ELELLRRVLA ACPNVTVVLT KTDLSAQWRQ VLQRDRAHLA RAGVGAKVLP VSSALRLRAA       240
     RTGDRELNAE SGFPELLACV QRDIVAAADV LGRRSVAAAA ASAVKQLVAP LKEELASMGA       300
     RGPEDTIAAL HEAQRRVDEL RRRSARWQTV LADEMADLVS DVEYDLRDRT RGILREVDRT       360
     FETADPGKVW DEFEPWLRTS LTEAATTNFA WLLERAEWVA EKVARSFPVH RDDLLPESVF       420
     PDDLLDRVAE MDAPTLERFT ASQKFFTGLR GSYGGVLMLG LVTSLAGMPL INAVSLGAGA       480
     LFGGRSVLEE GEQRLKRRQA AAKQSVQRHV DDFFVKFSKD CRDAARHVQR SLRDHFSTIA       540
     EELQETLLES ARSARRAVQD DATERERRTR EAKGELDGLV QLYQRVQAVA GVGAATPLSI       600
     TA                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page