(data stored in ACNUC7421 zone)

EMBL: CP001630.PE55

CP001630.PE55        Location/Qualifiers
FT   CDS             complement(60861..64376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0055"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   Methyltransferase type 12; Methyltransferase type 11; KEGG:
FT                   ppf:Pput_3926 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34029"
FT                   /db_xref="GOA:C6WDN4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34029.1"
FT                   /translation="MVEQPVYADGAEDEVLSRLRRAADVSAGSAELARALPSWELIYHF
FT                   SPQRTALLAPIELVEGTRVLDFGCGSGVLTRAMGELGAGVVGVEGTPTRAEAARERCRD
FT                   LPNVRIVDGGAEEIGLNGPFDLALLCGVLEYSSVYGDGPEALLEDVVGALEPGGALVLA
FT                   IENKIGLGYLTGRPEDHHGKSWVGLADYPRGGARTWPRAELAELLANAGLTAQRWMLPY
FT                   PDYKLPRVIVDADVHGRGDAVDLVDKLVRDPLYGAFGGTTGAVPGRSLHRTAVVEGFGA
FT                   SVSPSFLVVAARTPEAVRRFVRPGLGWLVNSARLPRWRRSRVLTTALELRAVEGAGAES
FT                   DWLRQEAPAVEPLLPGRPLDSLLLEALARGDEEELRGLLGLWRSCCEEGATGLGDQPRH
FT                   PFLPGAPGVPVLAANALDVHPGNVVLLPDGSPRRIDLEWCAGEGVDAELVLVRALLEFA
FT                   REVHRSGAPHPWEAELTTAELTLRLCGLVGLAGRARERWSELLAAEARLQELVSGTPSD
FT                   EVLTALLGDVDRPGPARAWELPPLTQLAAAAADREHLRGVADELRGDVARAEDALDATR
FT                   RLREEAMAALAEVERLREEATAEAAHLRRAVAKADEQLGDALMLVADAESERVGVEREL
FT                   AERSSRAEELAGENARLRTELDRLASSSVVRAGNRYLWPAARLVRGARDLALGRGGEEP
FT                   DRVLRGVGKVAPSAVPLLAGRVRRVSERDAGLRYQLSAPSEVPVGLGQVVDLDGWAVHD
FT                   DLPVRAVSVELGGRVLPATSGHPRPDVAAALGVHGWTGFRVRLPVRAGAVRPVLLVELA
FT                   DATVLRRELPELVGVPHEPEPVAVDWPGEGPRIAVCLATYNAPGGHFHEQVQSIKEQTH
FT                   SNWVCLISDDGSTDKAALRSATAGDPRFVVVEHAENVGFYRNFGRALAMVPVDADLVAL
FT                   SDQDDVWDADKLAVMAERFADPSVQLAYCDMRLVDGGGAVVAESAWTNRPNQWTDLEQL
FT                   LLLNTVTGAATVLRADLLRERVLPLPPGTPAAYHDQWIAATALAVGRIEFVDRALQSYR
FT                   QHGANVTGWQVPRLADGLPGLRGLAAAGAGVGHGVDLLEARQAELDHITEHELRRIAQF
FT                   STVLLMRNQDLLSERETAKLERLAGAERRLWPLVRLALEGEERPETAGAERRLLAAALL
FT                   RRHQQ"
     MVEQPVYADG AEDEVLSRLR RAADVSAGSA ELARALPSWE LIYHFSPQRT ALLAPIELVE        60
     GTRVLDFGCG SGVLTRAMGE LGAGVVGVEG TPTRAEAARE RCRDLPNVRI VDGGAEEIGL       120
     NGPFDLALLC GVLEYSSVYG DGPEALLEDV VGALEPGGAL VLAIENKIGL GYLTGRPEDH       180
     HGKSWVGLAD YPRGGARTWP RAELAELLAN AGLTAQRWML PYPDYKLPRV IVDADVHGRG       240
     DAVDLVDKLV RDPLYGAFGG TTGAVPGRSL HRTAVVEGFG ASVSPSFLVV AARTPEAVRR       300
     FVRPGLGWLV NSARLPRWRR SRVLTTALEL RAVEGAGAES DWLRQEAPAV EPLLPGRPLD       360
     SLLLEALARG DEEELRGLLG LWRSCCEEGA TGLGDQPRHP FLPGAPGVPV LAANALDVHP       420
     GNVVLLPDGS PRRIDLEWCA GEGVDAELVL VRALLEFARE VHRSGAPHPW EAELTTAELT       480
     LRLCGLVGLA GRARERWSEL LAAEARLQEL VSGTPSDEVL TALLGDVDRP GPARAWELPP       540
     LTQLAAAAAD REHLRGVADE LRGDVARAED ALDATRRLRE EAMAALAEVE RLREEATAEA       600
     AHLRRAVAKA DEQLGDALML VADAESERVG VERELAERSS RAEELAGENA RLRTELDRLA       660
     SSSVVRAGNR YLWPAARLVR GARDLALGRG GEEPDRVLRG VGKVAPSAVP LLAGRVRRVS       720
     ERDAGLRYQL SAPSEVPVGL GQVVDLDGWA VHDDLPVRAV SVELGGRVLP ATSGHPRPDV       780
     AAALGVHGWT GFRVRLPVRA GAVRPVLLVE LADATVLRRE LPELVGVPHE PEPVAVDWPG       840
     EGPRIAVCLA TYNAPGGHFH EQVQSIKEQT HSNWVCLISD DGSTDKAALR SATAGDPRFV       900
     VVEHAENVGF YRNFGRALAM VPVDADLVAL SDQDDVWDAD KLAVMAERFA DPSVQLAYCD       960
     MRLVDGGGAV VAESAWTNRP NQWTDLEQLL LLNTVTGAAT VLRADLLRER VLPLPPGTPA      1020
     AYHDQWIAAT ALAVGRIEFV DRALQSYRQH GANVTGWQVP RLADGLPGLR GLAAAGAGVG      1080
     HGVDLLEARQ AELDHITEHE LRRIAQFSTV LLMRNQDLLS ERETAKLERL AGAERRLWPL      1140
     VRLALEGEER PETAGAERRL LAAALLRRHQ Q                                     1171
//

If you have problems or comments...

PBIL Back to PBIL home page