(data stored in ACNUC7421 zone)

EMBL: CP001630.PE550

CP001630.PE550       Location/Qualifiers
FT   CDS             complement(602010..602867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAS0321a hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34524"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34524.1"
FT                   /translation="MVATPDTLHDFVLDLLSNPSALAAFQVDAEGCLAAAGLSDVTALD
FT                   VQEVIPLVLDFAPSAGLPALDGIVAGDLDLDLEGSVSAIAQLQAVTQQLTGVVGAGSDL
FT                   NLGAVGALTADASGVGLLGGNGDLGLGLGADVATSVDATVATSFSAVGDVTATLDGATT
FT                   AVTQTAAGVDTTVDATLSGAVDTLDGTVGSALPGLDGVTSPLFDTVGSVHGSVSAVADQ
FT                   AFGALGGGGLDLGATLEPVGDLTQHVTATVSATAHNAGVGGVTDAVGHATAPIAESPLG
FT                   DLLF"
     MVATPDTLHD FVLDLLSNPS ALAAFQVDAE GCLAAAGLSD VTALDVQEVI PLVLDFAPSA        60
     GLPALDGIVA GDLDLDLEGS VSAIAQLQAV TQQLTGVVGA GSDLNLGAVG ALTADASGVG       120
     LLGGNGDLGL GLGADVATSV DATVATSFSA VGDVTATLDG ATTAVTQTAA GVDTTVDATL       180
     SGAVDTLDGT VGSALPGLDG VTSPLFDTVG SVHGSVSAVA DQAFGALGGG GLDLGATLEP       240
     VGDLTQHVTA TVSATAHNAG VGGVTDAVGH ATAPIAESPL GDLLF                       285
//

If you have problems or comments...

PBIL Back to PBIL home page