(data stored in ACNUC7421 zone)

EMBL: CP001630.PE551

CP001630.PE551       Location/Qualifiers
FT   CDS             603113..604432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0558"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: hha:Hhal_0145 heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34525"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ93"
FT                   /inference="protein motif:COG:COG0443"
FT                   /protein_id="ACU34525.1"
FT                   /translation="MSYVLGVDAGSTRTSAAVCHLGGAGRSEAEVVGLGGPGGGVATCL
FT                   QLTADGDFAVGEPGDPRWTASDFVRRVGDDVPVVLGADPCTPQELVGLLVAHVARRVAE
FT                   REGEPPAHVVLSHPPGWGPHARALVHAALRDAGLARVTLLPEPLAVAADHAENHRGRTG
FT                   LLAVLGVGSHATTSALVRLAPNGEHELLAWSEEADRWAGADLDDLVFAHVAAELGGLDP
FT                   AQPHLLPAVARLRRDCESAKRVLSGVPVTAVPVHLPDGRVDVELTRERFEELARPGVEL
FT                   AVRGLERLCRGHRPDAIALVGGTARTPLLASAVTAAVPGRLVLAAAPETCAVRGAALAG
FT                   RRLLLGPDTGPDHGETSVLVHGDDPSLRFPVGQLAWDDAESAAPPPRPPVEITPLDLPT
FT                   PLSVKRVVRRGLAPIGRSRRRGGRSEPDPRHRTRHDEDGR"
     MSYVLGVDAG STRTSAAVCH LGGAGRSEAE VVGLGGPGGG VATCLQLTAD GDFAVGEPGD        60
     PRWTASDFVR RVGDDVPVVL GADPCTPQEL VGLLVAHVAR RVAEREGEPP AHVVLSHPPG       120
     WGPHARALVH AALRDAGLAR VTLLPEPLAV AADHAENHRG RTGLLAVLGV GSHATTSALV       180
     RLAPNGEHEL LAWSEEADRW AGADLDDLVF AHVAAELGGL DPAQPHLLPA VARLRRDCES       240
     AKRVLSGVPV TAVPVHLPDG RVDVELTRER FEELARPGVE LAVRGLERLC RGHRPDAIAL       300
     VGGTARTPLL ASAVTAAVPG RLVLAAAPET CAVRGAALAG RRLLLGPDTG PDHGETSVLV       360
     HGDDPSLRFP VGQLAWDDAE SAAPPPRPPV EITPLDLPTP LSVKRVVRRG LAPIGRSRRR       420
     GGRSEPDPRH RTRHDEDGR                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page