(data stored in ACNUC7421 zone)

EMBL: CP001630.PE552

CP001630.PE552       Location/Qualifiers
FT   CDS             604441..606807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0559"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ank:AnaeK_3854 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34526"
FT                   /db_xref="GOA:C6WJ94"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ94"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACU34526.1"
FT                   /translation="MTTPPKPVLDTAARALLDEIAANPGAVLRLGVLAPGGHGKTTLLR
FT                   EVERALAQNGADVTAVDDAHLLGDDELRALRALVERGDTSVVVAYRPWPRSRALAALAE
FT                   SLGRVRPAHLPAPLTREQVRHALPPSTGRALVDFVHQQTGGVPRFVARLSGLTSPELTP
FT                   DVIASFRADLDWLDPDAQKFLLAAEAGAALRLDLLRSLLGGDADRVADVIDAARATGLL
FT                   APDGTLLPVARTAVAALSRTDRRIAVRRALAESQLRAGGPVLDLVRPLLTAPGPELSEL
FT                   FKAAAAEALPSDPALAARLLAAIGTPTPEVAVRHATASAMAGDLDSALRLADRVVAAGD
FT                   QTHRGAAAEVAAIALAHRGQLARSTELHRWSPSATSTAFAHIGQIGVGALPAAPLPPAP
FT                   PTLLGGAASLMAHGVLESVTGSPTTALSTLVRASGLLEPAGAGVLLPDSPAALAALVAL
FT                   HSGEPVVAESALDRAVASGLGGSLMAVRHRLLRAWIAMGRGNLERARETITALRRANRP
FT                   LEPRDWIFAVALEIGIARRNSDLPTLKRTWEQACEAVLRHPVDLYTFLPLGEFAAAAAR
FT                   LRDQHRLAPHLAAAEDLLRGLGNPALWAVPLHWSGLHAAVIAEEIPAAEEHAAALAAHR
FT                   DSGRYCAIVSSAAESWLDVLAGKVDPDQVERAARGLHAAGQWWDAARLAGQAAIRTSDR
FT                   QAMVRLLDCARLLQGRPLGGRKPVEPETGQETGKLSDREREVAELVVGGLTYKQVGDRL
FT                   FISAKTVEHHVARIRQRLGCTSRAELLDQLRQIVG"
     MTTPPKPVLD TAARALLDEI AANPGAVLRL GVLAPGGHGK TTLLREVERA LAQNGADVTA        60
     VDDAHLLGDD ELRALRALVE RGDTSVVVAY RPWPRSRALA ALAESLGRVR PAHLPAPLTR       120
     EQVRHALPPS TGRALVDFVH QQTGGVPRFV ARLSGLTSPE LTPDVIASFR ADLDWLDPDA       180
     QKFLLAAEAG AALRLDLLRS LLGGDADRVA DVIDAARATG LLAPDGTLLP VARTAVAALS       240
     RTDRRIAVRR ALAESQLRAG GPVLDLVRPL LTAPGPELSE LFKAAAAEAL PSDPALAARL       300
     LAAIGTPTPE VAVRHATASA MAGDLDSALR LADRVVAAGD QTHRGAAAEV AAIALAHRGQ       360
     LARSTELHRW SPSATSTAFA HIGQIGVGAL PAAPLPPAPP TLLGGAASLM AHGVLESVTG       420
     SPTTALSTLV RASGLLEPAG AGVLLPDSPA ALAALVALHS GEPVVAESAL DRAVASGLGG       480
     SLMAVRHRLL RAWIAMGRGN LERARETITA LRRANRPLEP RDWIFAVALE IGIARRNSDL       540
     PTLKRTWEQA CEAVLRHPVD LYTFLPLGEF AAAAARLRDQ HRLAPHLAAA EDLLRGLGNP       600
     ALWAVPLHWS GLHAAVIAEE IPAAEEHAAA LAAHRDSGRY CAIVSSAAES WLDVLAGKVD       660
     PDQVERAARG LHAAGQWWDA ARLAGQAAIR TSDRQAMVRL LDCARLLQGR PLGGRKPVEP       720
     ETGQETGKLS DREREVAELV VGGLTYKQVG DRLFISAKTV EHHVARIRQR LGCTSRAELL       780
     DQLRQIVG                                                                788
//

If you have problems or comments...

PBIL Back to PBIL home page