(data stored in ACNUC7421 zone)

EMBL: CP001630.PE553

CP001630.PE553       Location/Qualifiers
FT   CDS             complement(607000..607530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0560"
FT                   /product="small integral membrane protein"
FT                   /note="KEGG: hch:HCH_05440 small integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34527"
FT                   /db_xref="GOA:C6WJ95"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ95"
FT                   /inference="similar to AA sequence:KEGG:HCH_05440"
FT                   /protein_id="ACU34527.1"
FT                   /translation="MRFLARVGGPRAAVVVLTAVAGVYMALVAFNNVTDYGSNHAFVQH
FT                   VFAMDTTFGAPSAAWRAITSPALVTVAYVLIIAWEALTAVVLLVGLGAWLSGRSRLGSL
FT                   LSGTGFGMQVLLFGLGFIVIGGEWFLMWQSKQWNGLAPALQNVVIAGFGLVLVHVAGRG
FT                   EPVVERADAGRAG"
     MRFLARVGGP RAAVVVLTAV AGVYMALVAF NNVTDYGSNH AFVQHVFAMD TTFGAPSAAW        60
     RAITSPALVT VAYVLIIAWE ALTAVVLLVG LGAWLSGRSR LGSLLSGTGF GMQVLLFGLG       120
     FIVIGGEWFL MWQSKQWNGL APALQNVVIA GFGLVLVHVA GRGEPVVERA DAGRAG           176
//

If you have problems or comments...

PBIL Back to PBIL home page