(data stored in ACNUC7421 zone)

EMBL: CP001630.PE554

CP001630.PE554       Location/Qualifiers
FT   CDS             complement(607655..611689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0561"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; SMART: WD-40 repeat
FT                   protein; KEGG: scl:sce4551 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34528"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ96"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ACU34528.1"
FT                   /translation="MVGNGHGSGPRTAFAERFALLYAEAGDPPLKRVTASVARSRRVDE
FT                   QGRPVRVTAQRVSDWRRGRNVPARFSALSVVLEVLIGEARKQRPTPPIPELHDLEAWRE
FT                   LWEQALASPVAAVESGPAEMPEESGVCPYRGLAAFQPEDSSWFFGRERSTAALVTRLDN
FT                   STEYGGIVVLVGASGAGKSSLVRAGLIPSIREGALADPSSATWPSAVMTPGAKPLAELV
FT                   ERVPELSAVLPPGGLPDDPPTERGAGPRSLGVIDFAERVRAAVAEHARARGGERLVLVV
FT                   DQFEEAFTLCGDDAQVQLFVQALAAACTPERPGGHAPALVVLGVRADFYGRCLAIPELA
FT                   DALQERQMVLGPMTSAELREAVARPARAAGLQLEAGLVELMLRDLGVRAGRTPVHGARG
FT                   AYDAGALPLLSHALLATWQRRQAGRLTIAGYRAAGGIQGAVAATAERAWADLPPAAQGA
FT                   ARPLLLRLVRIGADTHDTRRRSTRQELVGQAGDPAAAEEALEVLARARLVTLDAGSVEI
FT                   THEALIQAWPRLRGWIDQDREGELLRQRLEEDAAAWAEQGRDSSLLYRGARLEAARHWA
FT                   TRHRADGAGPTGATGDFLAVSGQHHRRGVWALRGGAALVVVLALIAGVAAVVAVRQRDD
FT                   AVFRQVVAEADKLLDRDPSLSAQLALVARGMRPSALDLGTRLISSGGAPLATPLTGHTG
FT                   AVYLTTFSPDGRTLATASYDRTVRLWDVTDRDDPKPLGEPLTGHGDWVSSAVFSPDGRT
FT                   LASAGKDGSVRLWDVADRARPRQLSTAESPGRDTVYLVAFSPDGRTLASAHADRAVRLW
FT                   DVTDPSAPKQVAELAGHGQQVRTVAFSPTGLLASGSDDATVRLWDVADPSAPRQAGEPL
FT                   GGFDSTVHSVAFSPDGRTLAAGSEDRSIRLWDVTDPAAPEARGRPLALHLAPVWSVAFS
FT                   PDGRVLASGAADSTARLWNVTDPARVQPLGKPLAGRSGTVFAVGFSPDGRALATGSLDP
FT                   VVRMWSLPSTVLVGHAARTVGPRFAPDGRALLTGSEDGTVRAWDLAGPGGPDAPTPIGD
FT                   RRDAGEPVRAVVLGEDGRTMVTAGPKAVRLWDVRPGAEPEPLGEPLPLRTRFSSPLALR
FT                   GNLLVTADEDDTVLLWDLSDRARPRQLGEPLTGHDGYVNVALLTPDGRFLVTGSADSAL
FT                   RVWDVSDPARPRAAGRFPGHDGPVRAGALSPDGRVLATAGDDKLVRLWDFSDPTAPRAL
FT                   GAPLAGHEEAVVAVVFTPDGRTLASGGEDARLRLWDTSAPALARPIGEGVVGHDSALRD
FT                   ISVSPDGSVVATSSADGTVRLWHLDADWARRRICARTGGVLTEDAWREHVPQLDYAPPC
FT                   R"
     MVGNGHGSGP RTAFAERFAL LYAEAGDPPL KRVTASVARS RRVDEQGRPV RVTAQRVSDW        60
     RRGRNVPARF SALSVVLEVL IGEARKQRPT PPIPELHDLE AWRELWEQAL ASPVAAVESG       120
     PAEMPEESGV CPYRGLAAFQ PEDSSWFFGR ERSTAALVTR LDNSTEYGGI VVLVGASGAG       180
     KSSLVRAGLI PSIREGALAD PSSATWPSAV MTPGAKPLAE LVERVPELSA VLPPGGLPDD       240
     PPTERGAGPR SLGVIDFAER VRAAVAEHAR ARGGERLVLV VDQFEEAFTL CGDDAQVQLF       300
     VQALAAACTP ERPGGHAPAL VVLGVRADFY GRCLAIPELA DALQERQMVL GPMTSAELRE       360
     AVARPARAAG LQLEAGLVEL MLRDLGVRAG RTPVHGARGA YDAGALPLLS HALLATWQRR       420
     QAGRLTIAGY RAAGGIQGAV AATAERAWAD LPPAAQGAAR PLLLRLVRIG ADTHDTRRRS       480
     TRQELVGQAG DPAAAEEALE VLARARLVTL DAGSVEITHE ALIQAWPRLR GWIDQDREGE       540
     LLRQRLEEDA AAWAEQGRDS SLLYRGARLE AARHWATRHR ADGAGPTGAT GDFLAVSGQH       600
     HRRGVWALRG GAALVVVLAL IAGVAAVVAV RQRDDAVFRQ VVAEADKLLD RDPSLSAQLA       660
     LVARGMRPSA LDLGTRLISS GGAPLATPLT GHTGAVYLTT FSPDGRTLAT ASYDRTVRLW       720
     DVTDRDDPKP LGEPLTGHGD WVSSAVFSPD GRTLASAGKD GSVRLWDVAD RARPRQLSTA       780
     ESPGRDTVYL VAFSPDGRTL ASAHADRAVR LWDVTDPSAP KQVAELAGHG QQVRTVAFSP       840
     TGLLASGSDD ATVRLWDVAD PSAPRQAGEP LGGFDSTVHS VAFSPDGRTL AAGSEDRSIR       900
     LWDVTDPAAP EARGRPLALH LAPVWSVAFS PDGRVLASGA ADSTARLWNV TDPARVQPLG       960
     KPLAGRSGTV FAVGFSPDGR ALATGSLDPV VRMWSLPSTV LVGHAARTVG PRFAPDGRAL      1020
     LTGSEDGTVR AWDLAGPGGP DAPTPIGDRR DAGEPVRAVV LGEDGRTMVT AGPKAVRLWD      1080
     VRPGAEPEPL GEPLPLRTRF SSPLALRGNL LVTADEDDTV LLWDLSDRAR PRQLGEPLTG      1140
     HDGYVNVALL TPDGRFLVTG SADSALRVWD VSDPARPRAA GRFPGHDGPV RAGALSPDGR      1200
     VLATAGDDKL VRLWDFSDPT APRALGAPLA GHEEAVVAVV FTPDGRTLAS GGEDARLRLW      1260
     DTSAPALARP IGEGVVGHDS ALRDISVSPD GSVVATSSAD GTVRLWHLDA DWARRRICAR      1320
     TGGVLTEDAW REHVPQLDYA PPCR                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page