(data stored in ACNUC7421 zone)

EMBL: CP001630.PE555

CP001630.PE555       Location/Qualifiers
FT   CDS             complement(612309..612665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to zinc finger protein 607"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34529"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34529.1"
FT                   /translation="MGRVGPVGCGSAGRPASAAWIVASFAVPVLPVPPSAPRPPPRRPR
FT                   ARVRARVRTRARLVVVRFPRAVGTGGRRFGELVRPIVRRVIRAGPGPGCGRRPAMGVGA
FT                   RSGEVPTTVSQVVW"
     MGRVGPVGCG SAGRPASAAW IVASFAVPVL PVPPSAPRPP PRRPRARVRA RVRTRARLVV        60
     VRFPRAVGTG GRRFGELVRP IVRRVIRAGP GPGCGRRPAM GVGARSGEVP TTVSQVVW         118
//

If you have problems or comments...

PBIL Back to PBIL home page